Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K6V7

Protein Details
Accession A0A3N4K6V7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-108ITSKPPPLPMTMRKKKRNKNTLTTTHydrophilic
NLS Segment(s)
PositionSequence
96-100RKKKR
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MQRKFSQPTASLLPFPTSFSFRNETNAPAKAQYLPPQLNVLPVEIPNDTLEPDTYGSPTGEEATIRRILDAFPTVIERTNQDKITSKPPPLPMTMRKKKRNKNTLTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.27
4 0.24
5 0.23
6 0.25
7 0.27
8 0.24
9 0.29
10 0.28
11 0.3
12 0.3
13 0.31
14 0.28
15 0.25
16 0.26
17 0.24
18 0.25
19 0.27
20 0.3
21 0.28
22 0.28
23 0.3
24 0.28
25 0.28
26 0.26
27 0.2
28 0.14
29 0.13
30 0.13
31 0.1
32 0.11
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.08
40 0.07
41 0.07
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.09
51 0.12
52 0.12
53 0.11
54 0.11
55 0.11
56 0.13
57 0.14
58 0.11
59 0.09
60 0.11
61 0.12
62 0.13
63 0.13
64 0.14
65 0.18
66 0.23
67 0.24
68 0.24
69 0.28
70 0.3
71 0.39
72 0.42
73 0.4
74 0.41
75 0.46
76 0.47
77 0.47
78 0.51
79 0.52
80 0.58
81 0.65
82 0.69
83 0.73
84 0.81
85 0.86
86 0.9
87 0.91
88 0.9