Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JYB6

Protein Details
Accession A0A3N4JYB6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
179-205GWCAGVLRRRERRTRLKLHNRRPAWASHydrophilic
NLS Segment(s)
PositionSequence
187-199RRERRTRLKLHNR
Subcellular Location(s) plas 14, mito 5, E.R. 4, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLSTTRFIILLAAFLILSASARSIPHGQEIMPVPPFHSTSYPYSTNNCDDACRHAFCAVVSQFLESVTCTSHKPCLSLNIQLHVQEKCLNWRPETTYSRTTISKDSTGISSPPPCDGGEEGTEAPSPLARPQKTWIHPVITSPVQEAGILEDEYEPRGLQMTARKTLCFMGVLATCFLGWCAGVLRRRERRTRLKLHNRRPAWASSISEKCEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.07
9 0.1
10 0.14
11 0.15
12 0.19
13 0.19
14 0.19
15 0.23
16 0.25
17 0.25
18 0.25
19 0.23
20 0.2
21 0.22
22 0.23
23 0.2
24 0.2
25 0.2
26 0.22
27 0.28
28 0.3
29 0.29
30 0.31
31 0.34
32 0.34
33 0.34
34 0.3
35 0.26
36 0.24
37 0.29
38 0.3
39 0.27
40 0.25
41 0.22
42 0.22
43 0.2
44 0.27
45 0.21
46 0.19
47 0.17
48 0.17
49 0.16
50 0.15
51 0.16
52 0.08
53 0.08
54 0.07
55 0.08
56 0.09
57 0.1
58 0.16
59 0.16
60 0.17
61 0.18
62 0.23
63 0.24
64 0.31
65 0.31
66 0.28
67 0.28
68 0.29
69 0.31
70 0.24
71 0.23
72 0.19
73 0.18
74 0.22
75 0.29
76 0.29
77 0.28
78 0.3
79 0.33
80 0.37
81 0.41
82 0.39
83 0.35
84 0.35
85 0.36
86 0.35
87 0.32
88 0.28
89 0.26
90 0.22
91 0.19
92 0.18
93 0.16
94 0.16
95 0.15
96 0.13
97 0.13
98 0.13
99 0.12
100 0.13
101 0.12
102 0.12
103 0.12
104 0.12
105 0.1
106 0.12
107 0.11
108 0.1
109 0.1
110 0.09
111 0.09
112 0.07
113 0.07
114 0.1
115 0.17
116 0.17
117 0.19
118 0.24
119 0.33
120 0.35
121 0.4
122 0.39
123 0.35
124 0.35
125 0.34
126 0.34
127 0.27
128 0.25
129 0.2
130 0.18
131 0.15
132 0.15
133 0.13
134 0.1
135 0.1
136 0.09
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.08
143 0.06
144 0.08
145 0.07
146 0.09
147 0.16
148 0.2
149 0.27
150 0.29
151 0.29
152 0.29
153 0.3
154 0.28
155 0.22
156 0.17
157 0.14
158 0.15
159 0.16
160 0.15
161 0.15
162 0.13
163 0.12
164 0.12
165 0.08
166 0.06
167 0.05
168 0.07
169 0.12
170 0.18
171 0.24
172 0.34
173 0.44
174 0.52
175 0.61
176 0.67
177 0.74
178 0.79
179 0.84
180 0.85
181 0.87
182 0.91
183 0.92
184 0.93
185 0.85
186 0.81
187 0.74
188 0.67
189 0.61
190 0.56
191 0.49
192 0.48
193 0.51