Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K7X6

Protein Details
Accession A0A3N4K7X6   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
21-51IAEEIRRKERRAQRRLRRKCPPQNSYHHIPCHydrophilic
NLS Segment(s)
PositionSequence
26-39RRKERRAQRRLRRK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAVTKLALELPNKSVDEMTTIAEEIRRKERRAQRRLRRKCPPQNSYHHIPCSAALDFARTATPEPLDPEKVHKLTLPVVEHYTKALPLEVARYSSHTPGLANAPTTDILGDAGEKDLRRRVAQRGIDLSRYRFTATQFQIPPATAEEESSDENLRRTSSHKRRSLSLHLVPTDRPDWTEQDECSDPTPTSIFSKVGPMLRKSESIWSVRHHNKHTEGVTPDDDSILNMRAGKFGYPWSCVCFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.22
4 0.19
5 0.18
6 0.14
7 0.14
8 0.14
9 0.16
10 0.19
11 0.2
12 0.29
13 0.33
14 0.35
15 0.45
16 0.55
17 0.63
18 0.71
19 0.78
20 0.79
21 0.84
22 0.92
23 0.93
24 0.93
25 0.94
26 0.94
27 0.93
28 0.91
29 0.88
30 0.87
31 0.85
32 0.83
33 0.79
34 0.71
35 0.61
36 0.53
37 0.45
38 0.39
39 0.32
40 0.24
41 0.16
42 0.16
43 0.15
44 0.15
45 0.14
46 0.11
47 0.12
48 0.12
49 0.13
50 0.11
51 0.15
52 0.18
53 0.21
54 0.21
55 0.25
56 0.31
57 0.31
58 0.3
59 0.27
60 0.26
61 0.27
62 0.31
63 0.27
64 0.22
65 0.25
66 0.25
67 0.24
68 0.23
69 0.2
70 0.15
71 0.13
72 0.12
73 0.09
74 0.08
75 0.11
76 0.1
77 0.11
78 0.11
79 0.14
80 0.16
81 0.16
82 0.17
83 0.14
84 0.13
85 0.13
86 0.16
87 0.13
88 0.12
89 0.11
90 0.11
91 0.11
92 0.11
93 0.09
94 0.06
95 0.06
96 0.05
97 0.05
98 0.04
99 0.04
100 0.06
101 0.06
102 0.07
103 0.1
104 0.12
105 0.14
106 0.16
107 0.21
108 0.27
109 0.3
110 0.31
111 0.34
112 0.34
113 0.37
114 0.36
115 0.33
116 0.26
117 0.25
118 0.23
119 0.19
120 0.19
121 0.23
122 0.24
123 0.29
124 0.28
125 0.29
126 0.29
127 0.27
128 0.26
129 0.18
130 0.19
131 0.11
132 0.11
133 0.11
134 0.11
135 0.12
136 0.12
137 0.12
138 0.1
139 0.11
140 0.12
141 0.11
142 0.11
143 0.14
144 0.24
145 0.33
146 0.43
147 0.49
148 0.5
149 0.54
150 0.6
151 0.65
152 0.62
153 0.58
154 0.54
155 0.5
156 0.49
157 0.45
158 0.42
159 0.35
160 0.26
161 0.22
162 0.18
163 0.19
164 0.22
165 0.25
166 0.21
167 0.25
168 0.26
169 0.26
170 0.25
171 0.24
172 0.19
173 0.17
174 0.18
175 0.15
176 0.16
177 0.17
178 0.16
179 0.14
180 0.19
181 0.21
182 0.26
183 0.29
184 0.28
185 0.31
186 0.33
187 0.34
188 0.31
189 0.35
190 0.35
191 0.34
192 0.35
193 0.34
194 0.42
195 0.49
196 0.55
197 0.52
198 0.55
199 0.56
200 0.61
201 0.58
202 0.55
203 0.5
204 0.47
205 0.45
206 0.39
207 0.34
208 0.28
209 0.26
210 0.2
211 0.19
212 0.16
213 0.15
214 0.15
215 0.15
216 0.16
217 0.17
218 0.17
219 0.16
220 0.22
221 0.24
222 0.26
223 0.27