Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JKK2

Protein Details
Accession A0A3N4JKK2   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-65LHYPAARQENKKKKKRKRNKDIYHYHPIPBasic
NLS Segment(s)
PositionSequence
45-56ENKKKKKRKRNK
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MYHLIMPITLVTFPTLSEPLTSHNPYYLIPITESHPLHYPAARQENKKKKKRKRNKDIYHYHPIPSAIPSSTNISPRVKPPIDKSTLDIPPPISRQEPGPKPPHTITFFPSIINKAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.12
5 0.12
6 0.15
7 0.22
8 0.24
9 0.21
10 0.22
11 0.23
12 0.22
13 0.26
14 0.24
15 0.18
16 0.17
17 0.17
18 0.18
19 0.24
20 0.24
21 0.21
22 0.21
23 0.22
24 0.23
25 0.23
26 0.22
27 0.22
28 0.32
29 0.35
30 0.38
31 0.47
32 0.56
33 0.66
34 0.73
35 0.77
36 0.78
37 0.85
38 0.9
39 0.91
40 0.92
41 0.93
42 0.94
43 0.94
44 0.92
45 0.88
46 0.87
47 0.77
48 0.66
49 0.56
50 0.46
51 0.36
52 0.28
53 0.22
54 0.12
55 0.11
56 0.12
57 0.15
58 0.17
59 0.19
60 0.21
61 0.23
62 0.24
63 0.26
64 0.33
65 0.31
66 0.32
67 0.36
68 0.42
69 0.44
70 0.43
71 0.44
72 0.43
73 0.45
74 0.42
75 0.37
76 0.31
77 0.3
78 0.31
79 0.31
80 0.24
81 0.22
82 0.28
83 0.36
84 0.4
85 0.44
86 0.5
87 0.49
88 0.54
89 0.57
90 0.59
91 0.54
92 0.5
93 0.46
94 0.45
95 0.43
96 0.38
97 0.38