Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JRT8

Protein Details
Accession A0A3N4JRT8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-112AEKAAAKRRVSKKPKVAKRGHEGGGBasic
NLS Segment(s)
PositionSequence
90-109KAAAKRRVSKKPKVAKRGHE
124-126KKR
Subcellular Location(s) nucl 16, cyto 8, mito 3
Family & Domain DBs
Amino Acid Sequences MASSDDYKFLLCCLMNSTGKIDFEAVARETGYTNPRSASNRLASIKKNHAAAMAAAATSGASSLTASSSREQPLAVPAVPPPQAQSAAEKAAAKRRVSKKPKVAKRGHEGGGEDDADTGDKGSKKRKGTASGDEDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.26
5 0.25
6 0.25
7 0.25
8 0.22
9 0.16
10 0.15
11 0.17
12 0.15
13 0.13
14 0.13
15 0.12
16 0.12
17 0.15
18 0.18
19 0.17
20 0.17
21 0.17
22 0.21
23 0.25
24 0.26
25 0.29
26 0.28
27 0.32
28 0.35
29 0.38
30 0.39
31 0.41
32 0.46
33 0.43
34 0.4
35 0.35
36 0.32
37 0.28
38 0.24
39 0.19
40 0.12
41 0.09
42 0.07
43 0.07
44 0.06
45 0.05
46 0.04
47 0.02
48 0.02
49 0.02
50 0.03
51 0.03
52 0.04
53 0.06
54 0.07
55 0.09
56 0.1
57 0.11
58 0.11
59 0.1
60 0.12
61 0.13
62 0.12
63 0.1
64 0.09
65 0.12
66 0.13
67 0.13
68 0.13
69 0.12
70 0.13
71 0.13
72 0.15
73 0.15
74 0.15
75 0.17
76 0.17
77 0.17
78 0.25
79 0.3
80 0.28
81 0.35
82 0.42
83 0.51
84 0.58
85 0.67
86 0.69
87 0.74
88 0.83
89 0.84
90 0.84
91 0.82
92 0.82
93 0.8
94 0.73
95 0.66
96 0.58
97 0.5
98 0.44
99 0.36
100 0.27
101 0.2
102 0.16
103 0.13
104 0.12
105 0.09
106 0.11
107 0.14
108 0.18
109 0.27
110 0.34
111 0.39
112 0.47
113 0.55
114 0.59
115 0.63
116 0.7