Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K3W3

Protein Details
Accession A0A3N4K3W3   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-52LLPGEREKDREKKREDKREERRRKPRRKIEGRKIDGGKRBasic
111-143QSGVKREKGTNIRKGNRKEKKSEKKKGRKNPLFBasic
NLS Segment(s)
PositionSequence
19-52REKDREKKREDKREERRRKPRRKIEGRKIDGGKR
105-141SKWTKRQSGVKREKGTNIRKGNRKEKKSEKKKGRKNP
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MRNTQYQALQKDILLPGEREKDREKKREDKREERRRKPRRKIEGRKIDGGKRVLVPSAERQREGDGGLGVEGEKSLGLGVGAWGVKLVTTGCGKRARERPVWWTSKWTKRQSGVKREKGTNIRKGNRKEKKSEKKKGRKNPLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.25
4 0.32
5 0.33
6 0.32
7 0.38
8 0.44
9 0.51
10 0.59
11 0.62
12 0.63
13 0.73
14 0.81
15 0.84
16 0.85
17 0.87
18 0.89
19 0.92
20 0.93
21 0.93
22 0.94
23 0.95
24 0.95
25 0.94
26 0.94
27 0.95
28 0.95
29 0.95
30 0.95
31 0.89
32 0.86
33 0.8
34 0.74
35 0.69
36 0.59
37 0.5
38 0.41
39 0.36
40 0.28
41 0.24
42 0.21
43 0.24
44 0.31
45 0.3
46 0.29
47 0.29
48 0.29
49 0.29
50 0.28
51 0.2
52 0.11
53 0.09
54 0.08
55 0.07
56 0.06
57 0.05
58 0.04
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.08
77 0.09
78 0.14
79 0.21
80 0.22
81 0.29
82 0.37
83 0.41
84 0.45
85 0.49
86 0.52
87 0.55
88 0.59
89 0.53
90 0.54
91 0.56
92 0.6
93 0.65
94 0.65
95 0.63
96 0.66
97 0.75
98 0.76
99 0.78
100 0.79
101 0.8
102 0.79
103 0.76
104 0.78
105 0.78
106 0.77
107 0.75
108 0.75
109 0.74
110 0.76
111 0.81
112 0.83
113 0.84
114 0.83
115 0.83
116 0.84
117 0.87
118 0.89
119 0.91
120 0.91
121 0.92
122 0.95
123 0.95