Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K3L8

Protein Details
Accession A0A3N4K3L8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-64KYPTRPSPFVKKRERKGKNKSKIKAKQSKABasic
NLS Segment(s)
PositionSequence
43-62FVKKRERKGKNKSKIKAKQS
Subcellular Location(s) mito 16, plas 6, nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRKKKSQSRTLSSLHFSPPLYSTPLHSTPLHIQKYPTRPSPFVKKRERKGKNKSKIKAKQSKAMDPLTIGSIFACLLSLGCEIYAWQDWKKMLANREGLEDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.52
3 0.44
4 0.36
5 0.31
6 0.28
7 0.24
8 0.23
9 0.2
10 0.2
11 0.24
12 0.26
13 0.27
14 0.26
15 0.27
16 0.32
17 0.41
18 0.4
19 0.35
20 0.35
21 0.39
22 0.47
23 0.48
24 0.48
25 0.44
26 0.44
27 0.48
28 0.57
29 0.58
30 0.6
31 0.65
32 0.67
33 0.71
34 0.79
35 0.84
36 0.83
37 0.86
38 0.87
39 0.87
40 0.87
41 0.85
42 0.85
43 0.85
44 0.85
45 0.84
46 0.77
47 0.74
48 0.7
49 0.69
50 0.64
51 0.57
52 0.46
53 0.37
54 0.34
55 0.27
56 0.22
57 0.15
58 0.1
59 0.08
60 0.08
61 0.07
62 0.06
63 0.04
64 0.04
65 0.05
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.08
72 0.12
73 0.14
74 0.15
75 0.18
76 0.19
77 0.22
78 0.29
79 0.32
80 0.34
81 0.39
82 0.44
83 0.41