Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J076

Protein Details
Accession A0A3N4J076    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MKKMKKMKKMKKMKKMKKMRKKMRKTGEKKEEGEBasic
NLS Segment(s)
PositionSequence
2-48KKMKKMKKMKKMKKMKKMRKKMRKTGEKKEEGEGRRRNKPSYVEKRG
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MKKMKKMKKMKKMKKMKKMRKKMRKTGEKKEEGEGRRRNKPSYVEKRGKASFEPLACDILQEQKSDRGSFHLLESYLSVQLLPMAYGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.95
4 0.94
5 0.95
6 0.95
7 0.95
8 0.95
9 0.95
10 0.94
11 0.94
12 0.92
13 0.91
14 0.91
15 0.87
16 0.79
17 0.75
18 0.72
19 0.64
20 0.65
21 0.62
22 0.57
23 0.58
24 0.59
25 0.54
26 0.51
27 0.54
28 0.56
29 0.58
30 0.62
31 0.6
32 0.59
33 0.63
34 0.61
35 0.55
36 0.45
37 0.39
38 0.33
39 0.27
40 0.28
41 0.22
42 0.22
43 0.2
44 0.2
45 0.16
46 0.18
47 0.19
48 0.17
49 0.17
50 0.21
51 0.24
52 0.24
53 0.24
54 0.22
55 0.24
56 0.24
57 0.24
58 0.22
59 0.2
60 0.2
61 0.21
62 0.18
63 0.16
64 0.15
65 0.13
66 0.09
67 0.11
68 0.1