Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IWW4

Protein Details
Accession A0A3N4IWW4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-77FDHPNPPKLKERKKDRKGGIDWBasic
NLS Segment(s)
PositionSequence
62-72PKLKERKKDRK
Subcellular Location(s) nucl 15, cyto 6, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MFWGAILYGHDGSMLPYHLYTTPYETKEQKKEAEVQLVREYQLELAEVEWFNQMGFDHPNPPKLKERKKDRKGGIDWFIYRECILNPLLYPLACNAQVTCPNLLIMEDNAPSHIHQYHDLPRERLGLRKLTWPANLPDLNPIESIWCEMKDRLRERLGIRMTATAICQVVLEEWINYPAERINKYIDSMPLRIEACIKDEGGNGFNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.12
5 0.13
6 0.15
7 0.15
8 0.2
9 0.25
10 0.27
11 0.33
12 0.38
13 0.45
14 0.51
15 0.55
16 0.52
17 0.5
18 0.55
19 0.54
20 0.58
21 0.51
22 0.47
23 0.48
24 0.46
25 0.42
26 0.34
27 0.3
28 0.2
29 0.19
30 0.15
31 0.09
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.08
39 0.09
40 0.09
41 0.08
42 0.11
43 0.12
44 0.19
45 0.21
46 0.28
47 0.3
48 0.34
49 0.42
50 0.48
51 0.57
52 0.59
53 0.69
54 0.73
55 0.8
56 0.86
57 0.83
58 0.83
59 0.78
60 0.76
61 0.7
62 0.64
63 0.56
64 0.49
65 0.42
66 0.33
67 0.28
68 0.21
69 0.15
70 0.12
71 0.12
72 0.09
73 0.09
74 0.1
75 0.1
76 0.09
77 0.09
78 0.08
79 0.09
80 0.09
81 0.09
82 0.07
83 0.09
84 0.13
85 0.14
86 0.14
87 0.12
88 0.12
89 0.12
90 0.11
91 0.1
92 0.07
93 0.07
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.09
100 0.09
101 0.09
102 0.1
103 0.13
104 0.2
105 0.27
106 0.29
107 0.29
108 0.29
109 0.33
110 0.32
111 0.33
112 0.29
113 0.27
114 0.27
115 0.32
116 0.34
117 0.32
118 0.33
119 0.32
120 0.3
121 0.32
122 0.31
123 0.25
124 0.27
125 0.25
126 0.25
127 0.22
128 0.2
129 0.15
130 0.14
131 0.16
132 0.12
133 0.11
134 0.12
135 0.14
136 0.19
137 0.27
138 0.3
139 0.34
140 0.35
141 0.4
142 0.4
143 0.47
144 0.44
145 0.38
146 0.36
147 0.31
148 0.3
149 0.25
150 0.24
151 0.17
152 0.14
153 0.12
154 0.11
155 0.09
156 0.08
157 0.09
158 0.09
159 0.08
160 0.08
161 0.1
162 0.11
163 0.11
164 0.11
165 0.13
166 0.18
167 0.19
168 0.2
169 0.24
170 0.25
171 0.27
172 0.3
173 0.33
174 0.32
175 0.32
176 0.32
177 0.31
178 0.3
179 0.28
180 0.29
181 0.23
182 0.22
183 0.23
184 0.22
185 0.19
186 0.21
187 0.23