Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3I0

Protein Details
Accession A0A3N4K3I0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-106SESDNGARQRRKKKTKKSRKSFKSQRKKSKSQKKKAKKRKAKMSNCEIHLBasic
NLS Segment(s)
PositionSequence
64-98RQRRKKKTKKSRKSFKSQRKKSKSQKKKAKKRKAK
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MGGLANRPSIEEPITKVWRLWNVTDRDDENDDDNNDDDDDDQNEEDDSEDESSGDESESDNGARQRRKKKTKKSRKSFKSQRKKSKSQKKKAKKRKAKMSNCEIHLIRRELEELKQLLTKNTNTIQVNSLPNTLHNPKILPVVEAYAVGNCLAPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.34
5 0.38
6 0.39
7 0.4
8 0.4
9 0.4
10 0.43
11 0.46
12 0.43
13 0.4
14 0.39
15 0.35
16 0.3
17 0.28
18 0.26
19 0.23
20 0.22
21 0.18
22 0.16
23 0.14
24 0.13
25 0.1
26 0.11
27 0.11
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.09
48 0.12
49 0.17
50 0.23
51 0.3
52 0.4
53 0.49
54 0.61
55 0.69
56 0.77
57 0.83
58 0.89
59 0.92
60 0.93
61 0.94
62 0.91
63 0.92
64 0.92
65 0.91
66 0.91
67 0.91
68 0.91
69 0.89
70 0.91
71 0.9
72 0.91
73 0.91
74 0.9
75 0.91
76 0.91
77 0.93
78 0.94
79 0.95
80 0.94
81 0.94
82 0.94
83 0.94
84 0.93
85 0.91
86 0.9
87 0.86
88 0.77
89 0.73
90 0.62
91 0.55
92 0.5
93 0.42
94 0.33
95 0.26
96 0.26
97 0.22
98 0.23
99 0.24
100 0.2
101 0.19
102 0.22
103 0.21
104 0.22
105 0.25
106 0.24
107 0.24
108 0.25
109 0.31
110 0.29
111 0.3
112 0.3
113 0.31
114 0.34
115 0.31
116 0.3
117 0.24
118 0.24
119 0.29
120 0.3
121 0.28
122 0.26
123 0.25
124 0.25
125 0.31
126 0.3
127 0.24
128 0.22
129 0.21
130 0.2
131 0.19
132 0.18
133 0.12
134 0.12
135 0.11
136 0.1