Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IX01

Protein Details
Accession A0A3N4IX01    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
5-24HHLRGRKSTGMKKSPRCSWNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MIVAHHLRGRKSTGMKKSPRCSWNLRILIPTQQTSRVKLHYRPRPRMSIQQLSSHSHNLNPPSPTHQISTMSQKAPHQSCSTSLHPSLRRSLQVPIHLRTPTPLPLILTNPPTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.75
4 0.79
5 0.81
6 0.76
7 0.73
8 0.71
9 0.68
10 0.69
11 0.65
12 0.58
13 0.52
14 0.49
15 0.49
16 0.45
17 0.39
18 0.3
19 0.33
20 0.33
21 0.34
22 0.36
23 0.35
24 0.37
25 0.42
26 0.5
27 0.52
28 0.61
29 0.66
30 0.68
31 0.68
32 0.68
33 0.69
34 0.67
35 0.66
36 0.58
37 0.55
38 0.53
39 0.5
40 0.48
41 0.41
42 0.34
43 0.26
44 0.26
45 0.23
46 0.23
47 0.2
48 0.19
49 0.22
50 0.24
51 0.24
52 0.23
53 0.22
54 0.22
55 0.23
56 0.3
57 0.29
58 0.27
59 0.28
60 0.28
61 0.34
62 0.33
63 0.35
64 0.29
65 0.26
66 0.28
67 0.32
68 0.33
69 0.31
70 0.32
71 0.35
72 0.38
73 0.39
74 0.42
75 0.4
76 0.39
77 0.36
78 0.41
79 0.39
80 0.43
81 0.45
82 0.42
83 0.43
84 0.41
85 0.4
86 0.36
87 0.34
88 0.3
89 0.27
90 0.26
91 0.23
92 0.25
93 0.29
94 0.32
95 0.31