Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IUY6

Protein Details
Accession A0A3N4IUY6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-34QSGIKERDRERKKQTTQKQRQTSINRQMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVQTQLQSGIKERDRERKKQTTQKQRQTSINRQMLYPPIPRIPHNNSTSPTPALSTPQLHLLSFRYVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.66
4 0.68
5 0.74
6 0.77
7 0.83
8 0.83
9 0.87
10 0.89
11 0.88
12 0.84
13 0.83
14 0.81
15 0.8
16 0.79
17 0.74
18 0.64
19 0.55
20 0.51
21 0.45
22 0.4
23 0.32
24 0.24
25 0.22
26 0.23
27 0.24
28 0.3
29 0.34
30 0.38
31 0.4
32 0.41
33 0.39
34 0.42
35 0.44
36 0.38
37 0.32
38 0.25
39 0.22
40 0.22
41 0.24
42 0.22
43 0.2
44 0.25
45 0.26
46 0.25
47 0.26
48 0.25
49 0.29