Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IRY6

Protein Details
Accession A0A3N4IRY6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-97ASPQTCKEAKEQRRKSTKKDRCKEGKVQRTKHVKKQRSKPAKKETSREAKEQRSKRTEKQKHKEAKGQRSQCVKKQMHKEANAQRNKHydrophilic
NLS Segment(s)
PositionSequence
18-79EAKEQRRKSTKKDRCKEGKVQRTKHVKKQRSKPAKKETSREAKEQRSKRTEKQKHKEAKGQR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences HKAKKQPPKEASPQTCKEAKEQRRKSTKKDRCKEGKVQRTKHVKKQRSKPAKKETSREAKEQRSKRTEKQKHKEAKGQRSQCVKKQMHKEANAQRNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.61
4 0.59
5 0.59
6 0.6
7 0.62
8 0.67
9 0.71
10 0.77
11 0.81
12 0.83
13 0.84
14 0.84
15 0.84
16 0.84
17 0.84
18 0.83
19 0.85
20 0.86
21 0.85
22 0.85
23 0.84
24 0.8
25 0.78
26 0.8
27 0.78
28 0.78
29 0.78
30 0.76
31 0.76
32 0.8
33 0.82
34 0.82
35 0.85
36 0.85
37 0.85
38 0.87
39 0.83
40 0.78
41 0.76
42 0.75
43 0.7
44 0.68
45 0.65
46 0.64
47 0.68
48 0.69
49 0.7
50 0.68
51 0.71
52 0.71
53 0.75
54 0.76
55 0.78
56 0.81
57 0.82
58 0.83
59 0.84
60 0.85
61 0.83
62 0.84
63 0.83
64 0.8
65 0.78
66 0.78
67 0.78
68 0.76
69 0.76
70 0.72
71 0.7
72 0.74
73 0.77
74 0.76
75 0.75
76 0.78
77 0.78