Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JNL4

Protein Details
Accession A0A3N4JNL4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-34RDNFQSSTKLNKNKNKNKNSKSRRNNFPNYTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MDRDNFQSSTKLNKNKNKNKNSKSRRNNFPNYTPINFPNEFGDTRAGWINSCMQWGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.84
4 0.85
5 0.87
6 0.87
7 0.89
8 0.9
9 0.9
10 0.9
11 0.89
12 0.88
13 0.87
14 0.87
15 0.81
16 0.75
17 0.72
18 0.66
19 0.59
20 0.51
21 0.43
22 0.4
23 0.35
24 0.31
25 0.27
26 0.24
27 0.23
28 0.21
29 0.22
30 0.16
31 0.18
32 0.21
33 0.18
34 0.16
35 0.17
36 0.2
37 0.18
38 0.2