Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JDX1

Protein Details
Accession A0A3N4JDX1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-52DEYSVKKSKDPRQLRKWIFRYPKEKWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences HIAKRLKWATAHKDWRAENFERVIWSDEYSVKKSKDPRQLRKWIFRYPKEKWNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.59
4 0.53
5 0.46
6 0.39
7 0.36
8 0.3
9 0.29
10 0.26
11 0.2
12 0.18
13 0.16
14 0.17
15 0.19
16 0.21
17 0.24
18 0.22
19 0.26
20 0.33
21 0.4
22 0.48
23 0.56
24 0.63
25 0.69
26 0.79
27 0.83
28 0.86
29 0.83
30 0.83
31 0.83
32 0.81
33 0.8
34 0.76