Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3A2

Protein Details
Accession A0A3N4K3A2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MNHANSKARWKKKYKSRKREFVDPRETQRKBasic
NLS Segment(s)
PositionSequence
7-19KARWKKKYKSRKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MNHANSKARWKKKYKSRKREFVDPRETQRKGTTRQFHESISISSRYSFTKGLSEDTSPPRPILPYHSPPPGSPEHNQHIPPPQKNPHQNRSNGSPPRNTQLPLVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.91
4 0.92
5 0.9
6 0.91
7 0.9
8 0.89
9 0.87
10 0.82
11 0.81
12 0.79
13 0.73
14 0.65
15 0.62
16 0.58
17 0.55
18 0.58
19 0.58
20 0.54
21 0.6
22 0.59
23 0.52
24 0.49
25 0.43
26 0.36
27 0.3
28 0.25
29 0.18
30 0.17
31 0.18
32 0.16
33 0.16
34 0.15
35 0.12
36 0.14
37 0.15
38 0.17
39 0.17
40 0.17
41 0.19
42 0.23
43 0.26
44 0.23
45 0.23
46 0.2
47 0.2
48 0.19
49 0.23
50 0.25
51 0.28
52 0.31
53 0.36
54 0.36
55 0.36
56 0.39
57 0.36
58 0.33
59 0.31
60 0.34
61 0.35
62 0.39
63 0.4
64 0.39
65 0.44
66 0.48
67 0.49
68 0.5
69 0.52
70 0.56
71 0.66
72 0.72
73 0.73
74 0.73
75 0.75
76 0.73
77 0.73
78 0.74
79 0.72
80 0.68
81 0.66
82 0.62
83 0.63
84 0.61
85 0.55