Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JEA6

Protein Details
Accession A0A3N4JEA6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
3-34IPTTPPQLNKIERKKRGPKPKRLHECHSHAAKBasic
NLS Segment(s)
PositionSequence
13-26IERKKRGPKPKRLH
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR006600  HTH_CenpB_DNA-bd_dom  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MTIPTTPPQLNKIERKKRGPKPKRLHECHSHAAKIKPPKMQEKAWSQAQKIWVLIFLFHHQVPTTPTIHSSNNSADLLRPPTQIEVSKLFGIPQRTISECVKNKEKIEGLGNRIHTNLCTSKSKVIGKWSEMESKLYERFMEGREKGQAIRRGLFRRHSLEIFRAVYSNTDKSIFKFSNGWFEEFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.84
4 0.87
5 0.9
6 0.9
7 0.9
8 0.91
9 0.93
10 0.94
11 0.91
12 0.89
13 0.87
14 0.84
15 0.83
16 0.77
17 0.71
18 0.66
19 0.62
20 0.6
21 0.6
22 0.58
23 0.54
24 0.55
25 0.59
26 0.59
27 0.61
28 0.61
29 0.59
30 0.59
31 0.62
32 0.61
33 0.53
34 0.51
35 0.49
36 0.43
37 0.36
38 0.3
39 0.23
40 0.18
41 0.18
42 0.16
43 0.14
44 0.15
45 0.14
46 0.15
47 0.12
48 0.13
49 0.15
50 0.16
51 0.15
52 0.13
53 0.15
54 0.18
55 0.19
56 0.19
57 0.2
58 0.18
59 0.2
60 0.2
61 0.17
62 0.15
63 0.16
64 0.2
65 0.19
66 0.18
67 0.15
68 0.16
69 0.18
70 0.18
71 0.18
72 0.16
73 0.16
74 0.16
75 0.16
76 0.16
77 0.16
78 0.18
79 0.15
80 0.15
81 0.15
82 0.16
83 0.19
84 0.2
85 0.26
86 0.28
87 0.32
88 0.35
89 0.37
90 0.36
91 0.37
92 0.36
93 0.3
94 0.33
95 0.32
96 0.3
97 0.31
98 0.32
99 0.28
100 0.27
101 0.25
102 0.19
103 0.19
104 0.18
105 0.18
106 0.2
107 0.21
108 0.24
109 0.3
110 0.34
111 0.32
112 0.37
113 0.37
114 0.36
115 0.38
116 0.37
117 0.38
118 0.35
119 0.35
120 0.29
121 0.29
122 0.28
123 0.25
124 0.22
125 0.18
126 0.19
127 0.19
128 0.25
129 0.23
130 0.24
131 0.27
132 0.28
133 0.29
134 0.35
135 0.39
136 0.35
137 0.39
138 0.43
139 0.46
140 0.5
141 0.54
142 0.53
143 0.52
144 0.53
145 0.52
146 0.49
147 0.46
148 0.48
149 0.43
150 0.37
151 0.33
152 0.28
153 0.28
154 0.29
155 0.27
156 0.22
157 0.23
158 0.23
159 0.25
160 0.34
161 0.31
162 0.28
163 0.32
164 0.32
165 0.4
166 0.42