Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JE78

Protein Details
Accession A0A3N4JE78   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-33SSTRRTRRNTLWRLWTRYKKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 3, E.R. 3, cyto 2, extr 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVVSIRLPQYNESSTRRTRRNTLWRLWTRYKKGWVVGVVLFIELVRFLLVFYRDDGRGQWAEEHAEGEDLGNLGWGEENLGREVTGVKRLVIVTCHAIWVGGVDGKNETKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.57
4 0.58
5 0.61
6 0.66
7 0.72
8 0.73
9 0.72
10 0.75
11 0.76
12 0.79
13 0.81
14 0.8
15 0.77
16 0.75
17 0.74
18 0.67
19 0.61
20 0.57
21 0.49
22 0.42
23 0.35
24 0.3
25 0.22
26 0.18
27 0.15
28 0.1
29 0.08
30 0.05
31 0.05
32 0.03
33 0.03
34 0.03
35 0.05
36 0.06
37 0.06
38 0.08
39 0.1
40 0.1
41 0.11
42 0.11
43 0.13
44 0.12
45 0.12
46 0.12
47 0.1
48 0.11
49 0.11
50 0.11
51 0.08
52 0.08
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.11
71 0.11
72 0.15
73 0.15
74 0.14
75 0.16
76 0.17
77 0.18
78 0.17
79 0.18
80 0.17
81 0.17
82 0.18
83 0.15
84 0.15
85 0.13
86 0.13
87 0.12
88 0.11
89 0.11
90 0.11
91 0.14