Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JAX3

Protein Details
Accession A0A3N4JAX3    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
136-184ESNREKIHQREKEKEKQREKEREKQRQKERERERERKREREKARMEESWBasic
NLS Segment(s)
PositionSequence
139-179REKIHQREKEKEKQREKEREKQRQKERERERERKREREKAR
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
Amino Acid Sequences MPHPKFLPRSLQNPHPNPNPRPLPPPYPRPPSTPFPPFPPVPKHFPRPSCMHVLRCACCREVHEKAQQAVRLEAGKGILEQRVEELEDYIRTHEEGMGRSVESVVEGLNDVLGWKYVIKLEKPKNKKEEEVSLSGESNREKIHQREKEKEKQREKEREKQRQKERERERERKREREKARMEESWGTMCDHYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.75
4 0.7
5 0.73
6 0.7
7 0.64
8 0.64
9 0.62
10 0.62
11 0.6
12 0.66
13 0.65
14 0.67
15 0.66
16 0.65
17 0.65
18 0.63
19 0.63
20 0.62
21 0.56
22 0.53
23 0.56
24 0.52
25 0.53
26 0.54
27 0.51
28 0.51
29 0.55
30 0.57
31 0.59
32 0.61
33 0.6
34 0.58
35 0.57
36 0.58
37 0.57
38 0.51
39 0.5
40 0.53
41 0.5
42 0.49
43 0.47
44 0.38
45 0.34
46 0.35
47 0.35
48 0.34
49 0.37
50 0.39
51 0.42
52 0.44
53 0.46
54 0.45
55 0.39
56 0.33
57 0.29
58 0.23
59 0.18
60 0.16
61 0.12
62 0.1
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.07
89 0.06
90 0.05
91 0.04
92 0.03
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.07
104 0.1
105 0.12
106 0.21
107 0.3
108 0.4
109 0.47
110 0.55
111 0.61
112 0.62
113 0.65
114 0.61
115 0.61
116 0.57
117 0.53
118 0.49
119 0.42
120 0.39
121 0.34
122 0.31
123 0.22
124 0.19
125 0.16
126 0.15
127 0.19
128 0.25
129 0.36
130 0.42
131 0.49
132 0.58
133 0.66
134 0.73
135 0.79
136 0.82
137 0.82
138 0.84
139 0.86
140 0.88
141 0.87
142 0.87
143 0.87
144 0.88
145 0.89
146 0.89
147 0.89
148 0.89
149 0.9
150 0.91
151 0.91
152 0.91
153 0.9
154 0.91
155 0.91
156 0.91
157 0.92
158 0.92
159 0.91
160 0.9
161 0.89
162 0.89
163 0.87
164 0.86
165 0.83
166 0.76
167 0.72
168 0.67
169 0.61
170 0.54
171 0.46
172 0.39