Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IWH6

Protein Details
Accession A0A3N4IWH6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-79KSVWGIFKKRYRKAVWKRKRIPCNHydrophilic
NLS Segment(s)
PositionSequence
63-75KKRYRKAVWKRKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025246  IS30-like_HTH  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13936  HTH_38  
Amino Acid Sequences MQQCKNSKRRELTEEERVPVILLYKEGKTYHKIGEEIGTSRTTIGRIDWTHLNPIKSVWGIFKKRYRKAVWKRKRIPCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.62
3 0.54
4 0.47
5 0.39
6 0.31
7 0.25
8 0.14
9 0.12
10 0.12
11 0.12
12 0.14
13 0.15
14 0.18
15 0.19
16 0.21
17 0.23
18 0.23
19 0.23
20 0.21
21 0.22
22 0.21
23 0.19
24 0.17
25 0.14
26 0.12
27 0.12
28 0.11
29 0.09
30 0.08
31 0.08
32 0.11
33 0.11
34 0.15
35 0.18
36 0.19
37 0.26
38 0.29
39 0.29
40 0.24
41 0.24
42 0.24
43 0.21
44 0.2
45 0.19
46 0.25
47 0.3
48 0.37
49 0.45
50 0.53
51 0.59
52 0.67
53 0.69
54 0.72
55 0.78
56 0.82
57 0.84
58 0.86
59 0.89