Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JNF1

Protein Details
Accession A0A3N4JNF1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-134TGEERRTGARRRNEWRGRKRKENKKNKNNRVQVWBasic
NLS Segment(s)
PositionSequence
104-128ERRTGARRRNEWRGRKRKENKKNKN
Subcellular Location(s) plas 15, E.R. 4, extr 3, mito 2, pero 1, golg 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGTIVHNDWPACLPAVLYCLVLYCVVLFCLVLSCIVLFYFVLSCIVLFCLVLFCTVLFCLVLSCLVLFLAGRQNYHAVMSERVSGYCEHNHALLYKRFPGTGEERRTGARRRNEWRGRKRKENKKNKNNRVQVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.11
5 0.1
6 0.09
7 0.1
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.04
25 0.05
26 0.05
27 0.05
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.09
57 0.09
58 0.09
59 0.1
60 0.11
61 0.11
62 0.12
63 0.13
64 0.1
65 0.11
66 0.12
67 0.14
68 0.13
69 0.13
70 0.14
71 0.13
72 0.14
73 0.15
74 0.16
75 0.14
76 0.14
77 0.15
78 0.16
79 0.2
80 0.21
81 0.22
82 0.25
83 0.25
84 0.24
85 0.25
86 0.28
87 0.3
88 0.36
89 0.39
90 0.37
91 0.38
92 0.41
93 0.45
94 0.48
95 0.48
96 0.49
97 0.52
98 0.57
99 0.67
100 0.74
101 0.8
102 0.84
103 0.87
104 0.86
105 0.89
106 0.91
107 0.92
108 0.92
109 0.93
110 0.93
111 0.94
112 0.96
113 0.96
114 0.96