Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JZB8

Protein Details
Accession A0A3N4JZB8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
49-93QSQSHHKKIKVVKERKKNGRLIFKDLKQCVRKPEGRLKHQKIFGSHydrophilic
NLS Segment(s)
PositionSequence
55-69KKIKVVKERKKNGRL
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MKSDNRAKVVAPPQPKIASSQPWALSSRECPTAQRQIRLNVTFRLNQNQSQSHHKKIKVVKERKKNGRLIFKDLKQCVRKPEGRLKHQKIFGSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.43
4 0.4
5 0.39
6 0.36
7 0.39
8 0.35
9 0.36
10 0.37
11 0.33
12 0.3
13 0.27
14 0.27
15 0.26
16 0.24
17 0.24
18 0.27
19 0.37
20 0.38
21 0.4
22 0.4
23 0.42
24 0.47
25 0.48
26 0.45
27 0.38
28 0.37
29 0.36
30 0.34
31 0.35
32 0.3
33 0.3
34 0.31
35 0.31
36 0.31
37 0.38
38 0.41
39 0.42
40 0.47
41 0.45
42 0.48
43 0.51
44 0.58
45 0.59
46 0.65
47 0.67
48 0.71
49 0.8
50 0.84
51 0.86
52 0.84
53 0.81
54 0.81
55 0.76
56 0.74
57 0.73
58 0.69
59 0.69
60 0.66
61 0.67
62 0.63
63 0.62
64 0.61
65 0.61
66 0.61
67 0.6
68 0.67
69 0.68
70 0.72
71 0.8
72 0.8
73 0.8
74 0.8
75 0.76