Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3G0

Protein Details
Accession A0A3N4K3G0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-43VSRGKTVASKAQRKKDRNKSYAKGRAEHydrophilic
NLS Segment(s)
PositionSequence
25-41SKAQRKKDRNKSYAKGR
Subcellular Location(s) mito 18.5, mito_nucl 12.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences TRTNPLDPVLKSSGLGVSRGKTVASKAQRKKDRNKSYAKGRAELEKELERASKAGEVIMKDASELPVSRRQAKLAARAAAVREANAKGQQNEEEEVAGDAAESEMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.19
4 0.17
5 0.19
6 0.19
7 0.18
8 0.15
9 0.17
10 0.24
11 0.31
12 0.4
13 0.46
14 0.56
15 0.66
16 0.73
17 0.81
18 0.83
19 0.85
20 0.83
21 0.84
22 0.82
23 0.83
24 0.83
25 0.75
26 0.68
27 0.59
28 0.57
29 0.5
30 0.44
31 0.37
32 0.3
33 0.28
34 0.25
35 0.24
36 0.17
37 0.15
38 0.14
39 0.11
40 0.08
41 0.09
42 0.09
43 0.09
44 0.1
45 0.1
46 0.09
47 0.08
48 0.09
49 0.08
50 0.08
51 0.08
52 0.1
53 0.16
54 0.19
55 0.23
56 0.23
57 0.24
58 0.29
59 0.32
60 0.37
61 0.36
62 0.36
63 0.33
64 0.33
65 0.33
66 0.32
67 0.29
68 0.21
69 0.19
70 0.18
71 0.2
72 0.23
73 0.26
74 0.22
75 0.25
76 0.27
77 0.27
78 0.28
79 0.25
80 0.21
81 0.18
82 0.17
83 0.14
84 0.11
85 0.08
86 0.06
87 0.05
88 0.05