Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K1F8

Protein Details
Accession A0A3N4K1F8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-51FIPQNRSGERKKKKKIRHHIDFPRECKRRBasic
NLS Segment(s)
PositionSequence
30-41GERKKKKKIRHH
Subcellular Location(s) plas 9, mito 4, cyto 4, E.R. 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRDVVLVTIRTNLLFFFFLTCSFIPQNRSGERKKKKKIRHHIDFPRECKRRSVRVLVRAILYSYAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.1
6 0.13
7 0.13
8 0.14
9 0.15
10 0.18
11 0.19
12 0.22
13 0.27
14 0.28
15 0.33
16 0.37
17 0.46
18 0.54
19 0.61
20 0.67
21 0.72
22 0.78
23 0.83
24 0.88
25 0.88
26 0.88
27 0.89
28 0.89
29 0.91
30 0.89
31 0.84
32 0.84
33 0.78
34 0.69
35 0.68
36 0.65
37 0.63
38 0.62
39 0.67
40 0.65
41 0.69
42 0.74
43 0.67
44 0.62
45 0.54
46 0.48