Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JMN3

Protein Details
Accession A0A3N4JMN3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-44GYTSLRILGKKRRIRKNKGKREESERKPNRBasic
NLS Segment(s)
PositionSequence
23-43GKKRRIRKNKGKREESERKPN
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MNLKPEFVPDLRVSGYTSLRILGKKRRIRKNKGKREESERKPNRISYALSHRSGTERVYKDLYRLEKRKLFFEQLGILQSIIAYRTDIPPFDAELPLPISGSVSSQGLTCVINNKLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.19
4 0.19
5 0.18
6 0.19
7 0.22
8 0.26
9 0.32
10 0.41
11 0.48
12 0.58
13 0.67
14 0.74
15 0.82
16 0.88
17 0.89
18 0.9
19 0.92
20 0.91
21 0.87
22 0.87
23 0.87
24 0.84
25 0.84
26 0.8
27 0.76
28 0.7
29 0.66
30 0.6
31 0.52
32 0.45
33 0.39
34 0.42
35 0.4
36 0.38
37 0.36
38 0.33
39 0.32
40 0.31
41 0.27
42 0.25
43 0.21
44 0.22
45 0.25
46 0.24
47 0.24
48 0.28
49 0.32
50 0.33
51 0.35
52 0.39
53 0.41
54 0.42
55 0.44
56 0.43
57 0.41
58 0.33
59 0.32
60 0.28
61 0.24
62 0.25
63 0.21
64 0.17
65 0.12
66 0.11
67 0.09
68 0.07
69 0.06
70 0.06
71 0.06
72 0.1
73 0.11
74 0.11
75 0.13
76 0.14
77 0.16
78 0.17
79 0.16
80 0.13
81 0.14
82 0.16
83 0.14
84 0.13
85 0.11
86 0.1
87 0.09
88 0.1
89 0.1
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.14
98 0.18