Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KBR2

Protein Details
Accession A0A3N4KBR2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-63KAELERLRRKRLEKRARRLDGEEBasic
NLS Segment(s)
PositionSequence
46-58RLRRKRLEKRARR
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MFPIAIMYYFGTNLDNRFSVPGFWPKPEETHKIPFERDEIKAELERLRRKRLEKRARRLDGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.14
5 0.14
6 0.13
7 0.16
8 0.23
9 0.23
10 0.24
11 0.26
12 0.25
13 0.3
14 0.33
15 0.35
16 0.31
17 0.37
18 0.39
19 0.38
20 0.38
21 0.34
22 0.33
23 0.31
24 0.28
25 0.24
26 0.22
27 0.22
28 0.23
29 0.24
30 0.25
31 0.29
32 0.37
33 0.39
34 0.46
35 0.5
36 0.57
37 0.66
38 0.72
39 0.76
40 0.78
41 0.83
42 0.86
43 0.88