Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J8R7

Protein Details
Accession A0A3N4J8R7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
40-62HIPASRSPKKRLRPKTPTPPASLHydrophilic
NLS Segment(s)
PositionSequence
45-54RSPKKRLRPK
Subcellular Location(s) nucl 13, mito 6, cyto 5, golg 2
Family & Domain DBs
Amino Acid Sequences MWCSSDCSGSREWRAVPIQVKNGSPVLTSSVSGYQGCRSHIPASRSPKKRLRPKTPTPPASLKVNITPVNVHWAKDCSIIRTGSLMDTNLNQQPLLHETKPADVMELPAWIRDLGPKQMWELQAENERTLRMGKISIHILAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.42
4 0.41
5 0.45
6 0.45
7 0.44
8 0.41
9 0.4
10 0.34
11 0.28
12 0.23
13 0.2
14 0.17
15 0.16
16 0.15
17 0.15
18 0.17
19 0.17
20 0.17
21 0.17
22 0.18
23 0.2
24 0.2
25 0.21
26 0.24
27 0.29
28 0.34
29 0.36
30 0.45
31 0.52
32 0.57
33 0.62
34 0.66
35 0.71
36 0.76
37 0.79
38 0.8
39 0.8
40 0.83
41 0.87
42 0.88
43 0.83
44 0.79
45 0.73
46 0.65
47 0.6
48 0.52
49 0.42
50 0.33
51 0.33
52 0.28
53 0.24
54 0.21
55 0.17
56 0.22
57 0.21
58 0.19
59 0.16
60 0.16
61 0.16
62 0.21
63 0.21
64 0.16
65 0.18
66 0.18
67 0.17
68 0.16
69 0.16
70 0.11
71 0.12
72 0.1
73 0.08
74 0.09
75 0.11
76 0.12
77 0.12
78 0.11
79 0.1
80 0.12
81 0.15
82 0.2
83 0.17
84 0.18
85 0.19
86 0.21
87 0.23
88 0.21
89 0.19
90 0.14
91 0.15
92 0.13
93 0.15
94 0.13
95 0.11
96 0.12
97 0.11
98 0.11
99 0.13
100 0.16
101 0.19
102 0.22
103 0.22
104 0.25
105 0.3
106 0.31
107 0.29
108 0.28
109 0.28
110 0.33
111 0.34
112 0.33
113 0.29
114 0.28
115 0.26
116 0.26
117 0.22
118 0.16
119 0.17
120 0.17
121 0.21
122 0.24