Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JGQ9

Protein Details
Accession A0A3N4JGQ9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25METAKTKQKKQKKPFHIKREDLDLAHydrophilic
NLS Segment(s)
PositionSequence
8-14QKKQKKP
Subcellular Location(s) nucl 11, mito 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039159  SAYSD1  
IPR019387  SAYSvFN_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10260  SAYSvFN  
Amino Acid Sequences METAKTKQKKQKKPFHIKREDLDLAGYKKDLQDRSPAHLFNRAVTSLRTSRQFHLYLLIQALAAAIGYGQLALCIGILWMCYVNTGKRAEGEKSAYSIFNENAEAIDGATNLEYLDRELRRQIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.9
5 0.83
6 0.81
7 0.72
8 0.61
9 0.53
10 0.47
11 0.38
12 0.32
13 0.28
14 0.2
15 0.2
16 0.25
17 0.25
18 0.21
19 0.28
20 0.3
21 0.36
22 0.4
23 0.39
24 0.34
25 0.4
26 0.38
27 0.31
28 0.31
29 0.25
30 0.22
31 0.21
32 0.24
33 0.2
34 0.23
35 0.26
36 0.26
37 0.27
38 0.31
39 0.32
40 0.27
41 0.28
42 0.25
43 0.21
44 0.18
45 0.16
46 0.11
47 0.1
48 0.09
49 0.05
50 0.04
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.06
70 0.08
71 0.12
72 0.13
73 0.13
74 0.16
75 0.19
76 0.2
77 0.23
78 0.27
79 0.24
80 0.25
81 0.26
82 0.23
83 0.22
84 0.23
85 0.19
86 0.16
87 0.16
88 0.14
89 0.12
90 0.13
91 0.11
92 0.09
93 0.09
94 0.07
95 0.07
96 0.07
97 0.07
98 0.05
99 0.06
100 0.06
101 0.08
102 0.15
103 0.16
104 0.19