Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J3U4

Protein Details
Accession A0A3N4J3U4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
90-121FLHTTRQKEVKERKKERKRRKRTGVVTIIEKSBasic
NLS Segment(s)
PositionSequence
97-111KEVKERKKERKRRKR
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTCVSPPFLSFALLVIFMFCTWCLLAWILDACLLRICESRSFTSLFCSSLSTSQARRRRGKEKTLVPFPRIFQNVIPLSCPYHREGPFSFLHTTRQKEVKERKKERKRRKRTGVVTIIEKSQSKRNWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.08
4 0.07
5 0.08
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.09
14 0.09
15 0.08
16 0.11
17 0.11
18 0.1
19 0.11
20 0.11
21 0.11
22 0.12
23 0.14
24 0.16
25 0.19
26 0.21
27 0.21
28 0.22
29 0.21
30 0.24
31 0.22
32 0.19
33 0.17
34 0.16
35 0.15
36 0.15
37 0.18
38 0.16
39 0.19
40 0.27
41 0.33
42 0.39
43 0.46
44 0.5
45 0.56
46 0.61
47 0.66
48 0.66
49 0.68
50 0.67
51 0.7
52 0.67
53 0.6
54 0.56
55 0.48
56 0.46
57 0.39
58 0.32
59 0.23
60 0.27
61 0.26
62 0.24
63 0.24
64 0.19
65 0.2
66 0.2
67 0.22
68 0.17
69 0.23
70 0.24
71 0.27
72 0.27
73 0.29
74 0.29
75 0.31
76 0.31
77 0.23
78 0.3
79 0.32
80 0.34
81 0.35
82 0.4
83 0.39
84 0.47
85 0.57
86 0.6
87 0.66
88 0.73
89 0.78
90 0.83
91 0.92
92 0.94
93 0.94
94 0.95
95 0.95
96 0.96
97 0.95
98 0.93
99 0.93
100 0.9
101 0.85
102 0.8
103 0.71
104 0.63
105 0.56
106 0.49
107 0.42
108 0.41