Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4ITU2

Protein Details
Accession A0A3N4ITU2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
301-322ELGKKEKQGEPGNPKKRRASYDBasic
NLS Segment(s)
PositionSequence
305-318KEKQGEPGNPKKRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027521  Usb1  
Gene Ontology GO:0005634  C:nucleus  
GO:0016829  F:lyase activity  
GO:1990838  F:poly(U)-specific exoribonuclease activity, producing 3' uridine cyclic phosphate ends  
GO:0034477  P:U6 snRNA 3'-end processing  
Pfam View protein in Pfam  
PF09749  HVSL  
Amino Acid Sequences MPPLTNSLVEYSDSDSDSPPPAKVTKTIHPTTPSTNQSTTLTSKYSKTSSSNSLPPLPSRFHDLYAVAPRVGQQDDPSLHGGRKRSIPHVQGNWPTHVFIEWHLSRSEFDILNDAYHTASTITAETGLKLESHLQSDLGSEQPLHLSLSKPNVLTTAQREGFLELLRDRLDKTRIKPFSVEFTGFEFVSNNDRTRWFFVLSATKGEDTQLPRLLQLANHTFESFEQPPLYAEENGDKLDGFHVSLAWSLTGPDKETKTKVLEALKKHACWDKILGDREDGKLKLVIDAIKVKIGSVVHIIELGKKEKQGEPGNPKKRRASYDIHEKRNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.23
5 0.23
6 0.2
7 0.22
8 0.23
9 0.25
10 0.3
11 0.34
12 0.37
13 0.45
14 0.47
15 0.49
16 0.52
17 0.53
18 0.54
19 0.56
20 0.53
21 0.49
22 0.47
23 0.44
24 0.42
25 0.42
26 0.39
27 0.33
28 0.31
29 0.28
30 0.29
31 0.31
32 0.32
33 0.31
34 0.32
35 0.34
36 0.38
37 0.42
38 0.45
39 0.45
40 0.48
41 0.46
42 0.46
43 0.45
44 0.4
45 0.36
46 0.38
47 0.35
48 0.31
49 0.31
50 0.28
51 0.29
52 0.34
53 0.34
54 0.26
55 0.24
56 0.24
57 0.25
58 0.25
59 0.2
60 0.14
61 0.19
62 0.2
63 0.23
64 0.24
65 0.23
66 0.23
67 0.26
68 0.27
69 0.25
70 0.3
71 0.31
72 0.35
73 0.41
74 0.45
75 0.5
76 0.53
77 0.56
78 0.59
79 0.58
80 0.55
81 0.48
82 0.42
83 0.34
84 0.29
85 0.23
86 0.15
87 0.21
88 0.18
89 0.18
90 0.18
91 0.19
92 0.18
93 0.2
94 0.22
95 0.14
96 0.14
97 0.16
98 0.16
99 0.15
100 0.15
101 0.13
102 0.1
103 0.09
104 0.09
105 0.06
106 0.05
107 0.05
108 0.06
109 0.05
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.1
118 0.09
119 0.11
120 0.11
121 0.11
122 0.11
123 0.11
124 0.12
125 0.09
126 0.08
127 0.06
128 0.06
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.09
135 0.13
136 0.15
137 0.15
138 0.15
139 0.15
140 0.15
141 0.16
142 0.17
143 0.21
144 0.19
145 0.19
146 0.2
147 0.19
148 0.19
149 0.17
150 0.15
151 0.08
152 0.09
153 0.09
154 0.09
155 0.1
156 0.12
157 0.18
158 0.2
159 0.23
160 0.32
161 0.34
162 0.35
163 0.36
164 0.34
165 0.35
166 0.33
167 0.31
168 0.22
169 0.23
170 0.23
171 0.21
172 0.2
173 0.14
174 0.11
175 0.15
176 0.16
177 0.14
178 0.14
179 0.16
180 0.18
181 0.22
182 0.23
183 0.19
184 0.18
185 0.2
186 0.26
187 0.25
188 0.25
189 0.22
190 0.21
191 0.19
192 0.19
193 0.2
194 0.16
195 0.19
196 0.21
197 0.2
198 0.2
199 0.21
200 0.21
201 0.18
202 0.21
203 0.21
204 0.19
205 0.19
206 0.19
207 0.18
208 0.18
209 0.24
210 0.2
211 0.18
212 0.16
213 0.15
214 0.16
215 0.19
216 0.21
217 0.14
218 0.14
219 0.15
220 0.16
221 0.16
222 0.16
223 0.13
224 0.1
225 0.11
226 0.1
227 0.08
228 0.07
229 0.07
230 0.07
231 0.08
232 0.08
233 0.07
234 0.06
235 0.07
236 0.1
237 0.1
238 0.12
239 0.16
240 0.19
241 0.23
242 0.26
243 0.29
244 0.3
245 0.32
246 0.35
247 0.39
248 0.43
249 0.43
250 0.51
251 0.52
252 0.49
253 0.51
254 0.52
255 0.45
256 0.41
257 0.41
258 0.39
259 0.41
260 0.45
261 0.42
262 0.4
263 0.42
264 0.42
265 0.43
266 0.35
267 0.3
268 0.27
269 0.26
270 0.23
271 0.23
272 0.21
273 0.2
274 0.25
275 0.24
276 0.24
277 0.24
278 0.22
279 0.22
280 0.21
281 0.19
282 0.17
283 0.17
284 0.14
285 0.16
286 0.17
287 0.18
288 0.22
289 0.24
290 0.23
291 0.24
292 0.28
293 0.3
294 0.39
295 0.43
296 0.49
297 0.56
298 0.65
299 0.73
300 0.77
301 0.8
302 0.81
303 0.81
304 0.78
305 0.74
306 0.72
307 0.71
308 0.75
309 0.77