Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JA77

Protein Details
Accession A0A3N4JA77   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
22-49NVPKTRKTFCKGKTCRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MHGSTDILSLDADIIRSFLQVNVPKTRKTFCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.08
5 0.08
6 0.15
7 0.2
8 0.25
9 0.34
10 0.37
11 0.4
12 0.42
13 0.47
14 0.46
15 0.47
16 0.51
17 0.5
18 0.58
19 0.65
20 0.73
21 0.79
22 0.8
23 0.85
24 0.84
25 0.87
26 0.87
27 0.88
28 0.85
29 0.85
30 0.86
31 0.79
32 0.78
33 0.71
34 0.65
35 0.57
36 0.5
37 0.4
38 0.32
39 0.3
40 0.3
41 0.29
42 0.25
43 0.31
44 0.34
45 0.38
46 0.43
47 0.47
48 0.43
49 0.5
50 0.57
51 0.54
52 0.56
53 0.55
54 0.55
55 0.54
56 0.57
57 0.49
58 0.44
59 0.41
60 0.34
61 0.37
62 0.39
63 0.38
64 0.33
65 0.4
66 0.44
67 0.53
68 0.61
69 0.64
70 0.63
71 0.67
72 0.74
73 0.74
74 0.73
75 0.7
76 0.65
77 0.62
78 0.6
79 0.55
80 0.5
81 0.47
82 0.41
83 0.35
84 0.33
85 0.32
86 0.36
87 0.42
88 0.44
89 0.47
90 0.57
91 0.64
92 0.69
93 0.66
94 0.61
95 0.56
96 0.51
97 0.5
98 0.5
99 0.51
100 0.52
101 0.55
102 0.52
103 0.5
104 0.49
105 0.42