Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K097

Protein Details
Accession A0A3N4K097   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
21-46MGKGERCKVIYRRVRKNPRLTHDGSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 4, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences IKYYGIVPENMYNMDEKGFTMGKGERCKVIYRRVRKNPRLTHDGSQEWVTVIEAVSAAGIVLPPMLINKGEAHSMGYETWLPFPTQKKVGLIRNSGGWSSSRKTLKYQPWSSNRLNLNWAKGKYRLLLLDGHTSHLTWEFFNFYLSHRVIPLCFPAHLTHLLQPLDVGLFGPLQHYYSAELDECIVKGEEGMNKEEFLQILLPARKRAYTENNILWAWEGAGIQPLNPRRVLDARSETKQSHTKKTSTILQTLSNNPTILHNLHRLSQTSPKVQTAAKSPRAATSSLLCGLHRIRSPVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.12
4 0.15
5 0.14
6 0.14
7 0.17
8 0.21
9 0.27
10 0.35
11 0.37
12 0.37
13 0.38
14 0.46
15 0.48
16 0.53
17 0.56
18 0.59
19 0.68
20 0.74
21 0.83
22 0.86
23 0.9
24 0.9
25 0.88
26 0.86
27 0.8
28 0.77
29 0.73
30 0.66
31 0.57
32 0.49
33 0.41
34 0.33
35 0.28
36 0.2
37 0.13
38 0.11
39 0.08
40 0.06
41 0.06
42 0.05
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.05
54 0.06
55 0.08
56 0.09
57 0.1
58 0.11
59 0.11
60 0.11
61 0.12
62 0.11
63 0.11
64 0.11
65 0.11
66 0.13
67 0.13
68 0.13
69 0.16
70 0.2
71 0.23
72 0.25
73 0.26
74 0.29
75 0.35
76 0.42
77 0.44
78 0.44
79 0.4
80 0.39
81 0.39
82 0.34
83 0.29
84 0.22
85 0.2
86 0.19
87 0.25
88 0.25
89 0.25
90 0.3
91 0.38
92 0.45
93 0.52
94 0.57
95 0.59
96 0.62
97 0.68
98 0.65
99 0.64
100 0.57
101 0.49
102 0.48
103 0.4
104 0.39
105 0.38
106 0.38
107 0.33
108 0.33
109 0.33
110 0.28
111 0.28
112 0.23
113 0.18
114 0.2
115 0.19
116 0.23
117 0.21
118 0.22
119 0.2
120 0.19
121 0.18
122 0.16
123 0.15
124 0.09
125 0.09
126 0.09
127 0.09
128 0.1
129 0.1
130 0.09
131 0.14
132 0.15
133 0.14
134 0.13
135 0.14
136 0.13
137 0.13
138 0.15
139 0.1
140 0.1
141 0.11
142 0.11
143 0.13
144 0.14
145 0.15
146 0.15
147 0.18
148 0.18
149 0.16
150 0.15
151 0.13
152 0.11
153 0.1
154 0.07
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.08
165 0.09
166 0.08
167 0.08
168 0.08
169 0.09
170 0.08
171 0.07
172 0.07
173 0.06
174 0.06
175 0.08
176 0.1
177 0.12
178 0.14
179 0.14
180 0.14
181 0.15
182 0.15
183 0.13
184 0.11
185 0.09
186 0.07
187 0.13
188 0.16
189 0.17
190 0.2
191 0.21
192 0.21
193 0.23
194 0.28
195 0.31
196 0.34
197 0.39
198 0.39
199 0.42
200 0.41
201 0.39
202 0.34
203 0.25
204 0.18
205 0.13
206 0.1
207 0.06
208 0.1
209 0.1
210 0.1
211 0.15
212 0.19
213 0.2
214 0.21
215 0.21
216 0.22
217 0.27
218 0.28
219 0.3
220 0.36
221 0.39
222 0.42
223 0.46
224 0.42
225 0.44
226 0.5
227 0.48
228 0.5
229 0.5
230 0.49
231 0.49
232 0.53
233 0.56
234 0.53
235 0.53
236 0.45
237 0.45
238 0.47
239 0.48
240 0.47
241 0.4
242 0.35
243 0.3
244 0.3
245 0.28
246 0.25
247 0.24
248 0.27
249 0.26
250 0.3
251 0.33
252 0.32
253 0.33
254 0.4
255 0.41
256 0.42
257 0.44
258 0.42
259 0.43
260 0.42
261 0.42
262 0.43
263 0.47
264 0.47
265 0.48
266 0.47
267 0.49
268 0.5
269 0.47
270 0.4
271 0.34
272 0.31
273 0.31
274 0.31
275 0.25
276 0.28
277 0.29
278 0.33
279 0.32