Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JMI2

Protein Details
Accession A0A3N4JMI2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-36TGKREKSKASHKNGQTRTKKRBasic
NLS Segment(s)
PositionSequence
17-36GKREKSKASHKNGQTRTKKR
Subcellular Location(s) mito 18.5, mito_nucl 13.166, nucl 6.5, cyto_nucl 5.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKHMVIFKGAQQKWGTGKREKSKASHKNGQTRTKKRNGFPQGFFHSMYLISSFFYNRFDILKEFYLSYSYFPILLFPIRLFRWRGGYYFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.47
4 0.56
5 0.59
6 0.67
7 0.67
8 0.66
9 0.69
10 0.73
11 0.74
12 0.73
13 0.71
14 0.73
15 0.78
16 0.81
17 0.8
18 0.8
19 0.8
20 0.8
21 0.79
22 0.73
23 0.75
24 0.74
25 0.7
26 0.64
27 0.63
28 0.59
29 0.54
30 0.51
31 0.4
32 0.31
33 0.24
34 0.21
35 0.14
36 0.08
37 0.06
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.09
44 0.1
45 0.11
46 0.12
47 0.15
48 0.17
49 0.16
50 0.16
51 0.16
52 0.17
53 0.16
54 0.16
55 0.15
56 0.13
57 0.12
58 0.11
59 0.12
60 0.12
61 0.13
62 0.13
63 0.11
64 0.16
65 0.18
66 0.22
67 0.24
68 0.26
69 0.32
70 0.33