Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JVB8

Protein Details
Accession A0A3N4JVB8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-86TFTKIWFGKPRNRKERKKKKKKEKKKEKKKINVKQDQNKAIKNLBasic
NLS Segment(s)
PositionSequence
50-73GKPRNRKERKKKKKKEKKKEKKKI
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MGSTVPLLVLRDIVTSIITRHYGLIKIKRHLIAIHPSSPPVDTFTKIWFGKPRNRKERKKKKKKEKKKEKKKINVKQDQNKAIKNLQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.11
5 0.11
6 0.11
7 0.12
8 0.14
9 0.17
10 0.23
11 0.3
12 0.33
13 0.36
14 0.4
15 0.4
16 0.39
17 0.37
18 0.35
19 0.35
20 0.33
21 0.34
22 0.29
23 0.28
24 0.28
25 0.27
26 0.22
27 0.17
28 0.15
29 0.12
30 0.13
31 0.14
32 0.2
33 0.2
34 0.22
35 0.24
36 0.28
37 0.35
38 0.44
39 0.53
40 0.58
41 0.68
42 0.77
43 0.82
44 0.89
45 0.92
46 0.94
47 0.95
48 0.95
49 0.97
50 0.97
51 0.97
52 0.97
53 0.97
54 0.97
55 0.97
56 0.97
57 0.97
58 0.96
59 0.95
60 0.95
61 0.94
62 0.93
63 0.92
64 0.91
65 0.9
66 0.86
67 0.81
68 0.75