Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JXX0

Protein Details
Accession A0A3N4JXX0   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
444-493AKHAATIAKKREKRQKLFQRRRERKEKTKEMKVQKRIKEAEKKELKKQEEBasic
496-519KMALKAGKKAKTREKEARNGWELEHydrophilic
NLS Segment(s)
PositionSequence
237-243KKKRGKK
445-512KHAATIAKKREKRQKLFQRRRERKEKTKEMKVQKRIKEAEKKELKKQEESAKMALKAGKKAKTREKEA
Subcellular Location(s) mito 14, mito_nucl 12.333, nucl 9.5, cyto_mito 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR002934  Polymerase_NTP_transf_dom  
IPR045862  Trf4-like  
Gene Ontology GO:0031499  C:TRAMP complex  
GO:0016779  F:nucleotidyltransferase activity  
GO:0043631  P:RNA polyadenylation  
Pfam View protein in Pfam  
PF01909  NTP_transf_2  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MLDRFASYAARLCLTAEGIARRGASIDRQRRVVQSVWPKAFCYPIGSYPTKTSLKNSDVDLLVSIPGQSEERKSLIRAATAMKEAVIGKCIAKPYNCTVIEGARVPILTYMDENEVPPLKFDISFQKENAVRNTSYLIEKFDERPFMRDLVIVIKHWYGLREKQLNEVYRGGLGSYAVALTVIGFFNVQRRKLDEKQYHAFITGSTYDMFVEYLEFWTKWKYKEYTMIPDPGEILTKKKRGKKGLGFMLRIMDPTDPENDVGRASHKVSRVFTAMVKLKGKIRRFGPDMNMGQLDYFLSATPAERKLFLKEKADQDRNNMKLHLKLQMRIRKAENKTSKAAQRSLTMMLEKQEEFLARRPTFAAQVAKAEHLLKDSDSPEQDLVSERGLNHDMPTIVPDKEEMQPQAAPEFDAATLENSEELVLLDDDEEEVKSPEQEKMEREAKHAATIAKKREKRQKLFQRRRERKEKTKEMKVQKRIKEAEKKELKKQEESAKMALKAGKKAKTREKEARNGWELELYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.19
5 0.2
6 0.22
7 0.21
8 0.19
9 0.2
10 0.19
11 0.25
12 0.32
13 0.4
14 0.44
15 0.49
16 0.52
17 0.54
18 0.57
19 0.51
20 0.5
21 0.51
22 0.56
23 0.57
24 0.55
25 0.53
26 0.5
27 0.5
28 0.42
29 0.37
30 0.3
31 0.29
32 0.36
33 0.37
34 0.38
35 0.39
36 0.45
37 0.43
38 0.41
39 0.41
40 0.42
41 0.43
42 0.43
43 0.42
44 0.4
45 0.36
46 0.35
47 0.3
48 0.22
49 0.19
50 0.16
51 0.14
52 0.08
53 0.09
54 0.1
55 0.11
56 0.13
57 0.16
58 0.19
59 0.21
60 0.22
61 0.27
62 0.27
63 0.27
64 0.26
65 0.27
66 0.28
67 0.28
68 0.27
69 0.2
70 0.2
71 0.2
72 0.18
73 0.16
74 0.14
75 0.13
76 0.16
77 0.19
78 0.21
79 0.21
80 0.25
81 0.29
82 0.37
83 0.37
84 0.36
85 0.34
86 0.32
87 0.34
88 0.31
89 0.26
90 0.17
91 0.17
92 0.15
93 0.15
94 0.14
95 0.11
96 0.1
97 0.11
98 0.13
99 0.14
100 0.14
101 0.15
102 0.18
103 0.17
104 0.17
105 0.17
106 0.15
107 0.15
108 0.17
109 0.24
110 0.27
111 0.3
112 0.3
113 0.36
114 0.38
115 0.41
116 0.44
117 0.39
118 0.32
119 0.3
120 0.32
121 0.27
122 0.27
123 0.24
124 0.22
125 0.19
126 0.21
127 0.24
128 0.25
129 0.3
130 0.28
131 0.3
132 0.29
133 0.28
134 0.26
135 0.23
136 0.21
137 0.2
138 0.2
139 0.18
140 0.18
141 0.16
142 0.17
143 0.17
144 0.18
145 0.16
146 0.2
147 0.28
148 0.32
149 0.32
150 0.38
151 0.45
152 0.45
153 0.44
154 0.41
155 0.33
156 0.27
157 0.27
158 0.19
159 0.13
160 0.1
161 0.07
162 0.05
163 0.05
164 0.04
165 0.04
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.12
174 0.16
175 0.18
176 0.18
177 0.23
178 0.31
179 0.37
180 0.47
181 0.47
182 0.5
183 0.54
184 0.56
185 0.51
186 0.44
187 0.38
188 0.28
189 0.24
190 0.17
191 0.13
192 0.1
193 0.1
194 0.09
195 0.09
196 0.09
197 0.06
198 0.06
199 0.05
200 0.06
201 0.08
202 0.08
203 0.08
204 0.13
205 0.16
206 0.17
207 0.23
208 0.24
209 0.25
210 0.33
211 0.37
212 0.39
213 0.4
214 0.42
215 0.36
216 0.34
217 0.32
218 0.24
219 0.23
220 0.15
221 0.17
222 0.19
223 0.25
224 0.31
225 0.37
226 0.45
227 0.5
228 0.59
229 0.62
230 0.65
231 0.68
232 0.69
233 0.63
234 0.56
235 0.51
236 0.41
237 0.33
238 0.25
239 0.16
240 0.1
241 0.1
242 0.11
243 0.09
244 0.09
245 0.1
246 0.09
247 0.09
248 0.09
249 0.09
250 0.1
251 0.11
252 0.14
253 0.16
254 0.19
255 0.2
256 0.21
257 0.21
258 0.21
259 0.19
260 0.22
261 0.23
262 0.24
263 0.24
264 0.24
265 0.28
266 0.34
267 0.36
268 0.35
269 0.34
270 0.37
271 0.4
272 0.42
273 0.41
274 0.42
275 0.4
276 0.36
277 0.33
278 0.27
279 0.22
280 0.19
281 0.15
282 0.07
283 0.06
284 0.04
285 0.04
286 0.05
287 0.05
288 0.08
289 0.11
290 0.11
291 0.13
292 0.14
293 0.19
294 0.25
295 0.28
296 0.3
297 0.33
298 0.41
299 0.49
300 0.54
301 0.51
302 0.52
303 0.57
304 0.55
305 0.52
306 0.45
307 0.37
308 0.35
309 0.36
310 0.36
311 0.29
312 0.31
313 0.38
314 0.43
315 0.44
316 0.44
317 0.47
318 0.49
319 0.51
320 0.57
321 0.57
322 0.54
323 0.55
324 0.57
325 0.57
326 0.53
327 0.53
328 0.45
329 0.38
330 0.36
331 0.35
332 0.3
333 0.26
334 0.22
335 0.19
336 0.2
337 0.18
338 0.16
339 0.15
340 0.14
341 0.15
342 0.2
343 0.28
344 0.25
345 0.26
346 0.27
347 0.27
348 0.28
349 0.3
350 0.28
351 0.2
352 0.23
353 0.23
354 0.23
355 0.23
356 0.22
357 0.18
358 0.15
359 0.15
360 0.12
361 0.15
362 0.15
363 0.18
364 0.18
365 0.19
366 0.18
367 0.17
368 0.17
369 0.16
370 0.16
371 0.14
372 0.15
373 0.12
374 0.16
375 0.18
376 0.17
377 0.15
378 0.16
379 0.15
380 0.13
381 0.16
382 0.15
383 0.14
384 0.13
385 0.14
386 0.14
387 0.16
388 0.2
389 0.19
390 0.19
391 0.2
392 0.2
393 0.21
394 0.18
395 0.16
396 0.13
397 0.12
398 0.1
399 0.09
400 0.09
401 0.09
402 0.09
403 0.09
404 0.08
405 0.07
406 0.07
407 0.07
408 0.06
409 0.06
410 0.06
411 0.06
412 0.06
413 0.06
414 0.06
415 0.07
416 0.07
417 0.06
418 0.08
419 0.08
420 0.1
421 0.12
422 0.15
423 0.19
424 0.22
425 0.25
426 0.31
427 0.38
428 0.37
429 0.39
430 0.43
431 0.4
432 0.39
433 0.4
434 0.36
435 0.38
436 0.44
437 0.51
438 0.54
439 0.59
440 0.65
441 0.73
442 0.79
443 0.79
444 0.83
445 0.84
446 0.86
447 0.91
448 0.92
449 0.93
450 0.93
451 0.94
452 0.94
453 0.93
454 0.92
455 0.92
456 0.93
457 0.92
458 0.92
459 0.92
460 0.92
461 0.92
462 0.91
463 0.9
464 0.86
465 0.87
466 0.84
467 0.84
468 0.83
469 0.79
470 0.8
471 0.81
472 0.79
473 0.78
474 0.8
475 0.76
476 0.72
477 0.73
478 0.72
479 0.71
480 0.7
481 0.67
482 0.64
483 0.6
484 0.57
485 0.54
486 0.49
487 0.48
488 0.51
489 0.52
490 0.53
491 0.62
492 0.68
493 0.73
494 0.78
495 0.8
496 0.81
497 0.83
498 0.85
499 0.85
500 0.8
501 0.73
502 0.65