Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JA56

Protein Details
Accession A0A3N4JA56    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ESSDRVLRERPPKVRKKRRKHSSPEVSPTLEBasic
NLS Segment(s)
PositionSequence
9-22RERPPKVRKKRRKH
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MESSDRVLRERPPKVRKKRRKHSSPEVSPTLEPPIDTDTNTKDTIHIRLQECPKTPIRVLFTGANFNFSPPGGPRLDGAPFQTTQSITPSDSSKQYLPMIHNALQLIKHASQLHSAQYMNPTKEQLFEQKLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.87
3 0.9
4 0.92
5 0.94
6 0.95
7 0.95
8 0.94
9 0.94
10 0.94
11 0.92
12 0.89
13 0.83
14 0.75
15 0.64
16 0.56
17 0.49
18 0.38
19 0.28
20 0.21
21 0.22
22 0.19
23 0.19
24 0.2
25 0.19
26 0.22
27 0.23
28 0.22
29 0.18
30 0.19
31 0.23
32 0.24
33 0.27
34 0.25
35 0.31
36 0.37
37 0.4
38 0.4
39 0.4
40 0.39
41 0.36
42 0.35
43 0.34
44 0.32
45 0.28
46 0.29
47 0.27
48 0.25
49 0.28
50 0.27
51 0.25
52 0.21
53 0.2
54 0.18
55 0.15
56 0.15
57 0.09
58 0.13
59 0.1
60 0.1
61 0.11
62 0.12
63 0.14
64 0.13
65 0.15
66 0.13
67 0.13
68 0.14
69 0.15
70 0.13
71 0.12
72 0.14
73 0.13
74 0.12
75 0.13
76 0.15
77 0.16
78 0.17
79 0.19
80 0.18
81 0.2
82 0.21
83 0.23
84 0.23
85 0.27
86 0.3
87 0.29
88 0.3
89 0.28
90 0.27
91 0.24
92 0.23
93 0.21
94 0.17
95 0.19
96 0.19
97 0.2
98 0.23
99 0.24
100 0.26
101 0.25
102 0.24
103 0.22
104 0.29
105 0.34
106 0.33
107 0.33
108 0.33
109 0.31
110 0.33
111 0.35
112 0.36
113 0.35