Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4J5Z5

Protein Details
Accession A0A3N4J5Z5    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-113EEEEKEKRERREKKLELKKREEKMEGERRKKLRKREDEIRVKRKKVBasic
195-215AFERLKERYKRDSRHGWERMSBasic
NLS Segment(s)
PositionSequence
70-141EEKEKRERREKKLELKKREEKMEGERRKKLRKREDEIRVKRKKVEEERVLEEKKEKEKKALGKLMEMRKNKK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MAGVEKLIDGVVRSRLESFLERIEVKPEDRDRRLEKIERVLGPDGGSKGNKKEDLESKVEEDSVLKREEEEKEKRERREKKLELKKREEKMEGERRKKLRKREDEIRVKRKKVEEERVLEEKKEKEKKALGKLMEMRKNKKVWEDWLSWNRYVVEVGNEGWKKLLEVRKLEFYEMSVEGLIEGSRDIRKFLDKWAFERLKERYKRDSRHGWERMSEEER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.24
5 0.24
6 0.22
7 0.25
8 0.26
9 0.25
10 0.29
11 0.29
12 0.27
13 0.33
14 0.38
15 0.43
16 0.45
17 0.53
18 0.53
19 0.57
20 0.64
21 0.62
22 0.59
23 0.59
24 0.62
25 0.56
26 0.55
27 0.5
28 0.43
29 0.37
30 0.34
31 0.27
32 0.23
33 0.23
34 0.21
35 0.24
36 0.28
37 0.3
38 0.29
39 0.34
40 0.38
41 0.42
42 0.44
43 0.41
44 0.38
45 0.35
46 0.34
47 0.27
48 0.21
49 0.18
50 0.17
51 0.16
52 0.13
53 0.14
54 0.18
55 0.22
56 0.29
57 0.33
58 0.35
59 0.45
60 0.52
61 0.58
62 0.64
63 0.69
64 0.7
65 0.74
66 0.77
67 0.78
68 0.82
69 0.85
70 0.84
71 0.85
72 0.85
73 0.79
74 0.76
75 0.68
76 0.61
77 0.61
78 0.62
79 0.62
80 0.59
81 0.61
82 0.62
83 0.7
84 0.72
85 0.72
86 0.72
87 0.73
88 0.74
89 0.77
90 0.81
91 0.81
92 0.85
93 0.86
94 0.82
95 0.74
96 0.71
97 0.65
98 0.64
99 0.61
100 0.61
101 0.58
102 0.55
103 0.58
104 0.6
105 0.57
106 0.48
107 0.43
108 0.38
109 0.4
110 0.43
111 0.38
112 0.37
113 0.42
114 0.49
115 0.54
116 0.56
117 0.47
118 0.46
119 0.52
120 0.56
121 0.57
122 0.56
123 0.52
124 0.52
125 0.54
126 0.5
127 0.48
128 0.44
129 0.42
130 0.43
131 0.43
132 0.45
133 0.51
134 0.53
135 0.47
136 0.45
137 0.39
138 0.33
139 0.29
140 0.2
141 0.15
142 0.12
143 0.12
144 0.18
145 0.18
146 0.18
147 0.18
148 0.17
149 0.15
150 0.21
151 0.27
152 0.25
153 0.3
154 0.33
155 0.41
156 0.42
157 0.43
158 0.36
159 0.3
160 0.28
161 0.24
162 0.21
163 0.13
164 0.12
165 0.1
166 0.11
167 0.09
168 0.06
169 0.05
170 0.07
171 0.1
172 0.11
173 0.12
174 0.14
175 0.19
176 0.2
177 0.29
178 0.36
179 0.36
180 0.38
181 0.48
182 0.5
183 0.46
184 0.53
185 0.52
186 0.53
187 0.59
188 0.62
189 0.63
190 0.69
191 0.75
192 0.76
193 0.8
194 0.78
195 0.81
196 0.81
197 0.75
198 0.71
199 0.66