Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JVN5

Protein Details
Accession A0A3N4JVN5    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-74LYKYRCPPLSPPLRKKKNPYQILYRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 9.5, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MYHTVPVLPTTTTTLHITSNTLFFPGTITTTTTTTTLPIQYTPKLSLLLYKYRCPPLSPPLRKKKNPYQILYRIIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.19
5 0.17
6 0.17
7 0.14
8 0.13
9 0.11
10 0.1
11 0.11
12 0.09
13 0.09
14 0.08
15 0.1
16 0.1
17 0.11
18 0.12
19 0.11
20 0.11
21 0.1
22 0.11
23 0.11
24 0.1
25 0.11
26 0.12
27 0.13
28 0.14
29 0.15
30 0.15
31 0.15
32 0.14
33 0.17
34 0.19
35 0.26
36 0.27
37 0.3
38 0.33
39 0.38
40 0.39
41 0.37
42 0.39
43 0.4
44 0.49
45 0.55
46 0.61
47 0.67
48 0.76
49 0.81
50 0.86
51 0.87
52 0.86
53 0.85
54 0.82
55 0.81
56 0.79