Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JCM1

Protein Details
Accession A0A3N4JCM1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-32EAIPTSQNPRNKRPTKRRALSPTSAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPEAIPTSQNPRNKRPTKRRALSPTSAQATALTNLFAKPDREIHMPTGPKTKSLPPPPEIVANVQGSSAGAGSGEFHVYKAARRREYERIRLMEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.58
4 0.63
5 0.73
6 0.76
7 0.81
8 0.85
9 0.87
10 0.88
11 0.87
12 0.85
13 0.8
14 0.76
15 0.72
16 0.64
17 0.56
18 0.46
19 0.37
20 0.31
21 0.26
22 0.19
23 0.12
24 0.09
25 0.09
26 0.1
27 0.11
28 0.1
29 0.1
30 0.12
31 0.15
32 0.17
33 0.19
34 0.21
35 0.25
36 0.26
37 0.26
38 0.31
39 0.27
40 0.26
41 0.27
42 0.3
43 0.33
44 0.4
45 0.44
46 0.38
47 0.42
48 0.41
49 0.42
50 0.37
51 0.31
52 0.27
53 0.22
54 0.2
55 0.16
56 0.15
57 0.12
58 0.11
59 0.09
60 0.04
61 0.03
62 0.03
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.1
69 0.11
70 0.17
71 0.25
72 0.33
73 0.37
74 0.42
75 0.49
76 0.57
77 0.66
78 0.7
79 0.71
80 0.67