Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J6Z8

Protein Details
Accession A0A3N4J6Z8   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
7-36VGGDKAHYKSYKKKYKKLRFKFDHFMKRSDBasic
NLS Segment(s)
PositionSequence
19-23KKYKK
352-364KKPGRGRGGGRRR
382-425AGSKRRRGEEAEETPNRGGRGPRGGRGGRRKPNEGGEPPVKKQR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR032742  Iec3  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF14612  Ino80_Iec3  
Amino Acid Sequences MSAAENVGGDKAHYKSYKKKYKKLRFKFDHFMKRSDELFKQDQIASAAIKRIHEENTRLLDLLVDLNSSSHVPKSRRFNIGSPSAATPTRFLSPTLLAAMGELDEEIAGLLDDNDVEPMQLEPTPVNGNDAEDEDQDDNSTDDDDEDDETPPIQRHGAKYSDDEDEDMDDDDREAYLEEIRESNHRRGIPGTPPRYIRDKLKADAERERKEAEEQAKKAAAEVAANGVNGSAPLVLKQEPVDEMPEGIQEPAPPHTPNNRKPLVLENTYRRGATPPYLRNTSPFLMSAEEEEAFYANVDENLNGEIPALPEITHTSPNASKGEGDPRNPMSVYCWLRKYQPQVFLQEAEGEKKPGRGRGGGRRRTAVDGDSGDEMPSTVKAAGSKRRRGEEAEETPNRGGRGPRGGRGGRRKPNEGGEPPVKKQRSVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.42
3 0.53
4 0.63
5 0.69
6 0.77
7 0.81
8 0.87
9 0.92
10 0.93
11 0.93
12 0.92
13 0.91
14 0.92
15 0.92
16 0.91
17 0.84
18 0.78
19 0.73
20 0.67
21 0.62
22 0.57
23 0.51
24 0.47
25 0.47
26 0.45
27 0.43
28 0.4
29 0.38
30 0.33
31 0.3
32 0.25
33 0.22
34 0.25
35 0.23
36 0.22
37 0.23
38 0.23
39 0.28
40 0.32
41 0.33
42 0.35
43 0.39
44 0.4
45 0.38
46 0.35
47 0.29
48 0.24
49 0.23
50 0.16
51 0.1
52 0.09
53 0.08
54 0.1
55 0.1
56 0.1
57 0.12
58 0.18
59 0.22
60 0.29
61 0.38
62 0.45
63 0.52
64 0.55
65 0.56
66 0.57
67 0.61
68 0.56
69 0.49
70 0.44
71 0.39
72 0.37
73 0.32
74 0.26
75 0.22
76 0.22
77 0.2
78 0.19
79 0.19
80 0.19
81 0.2
82 0.19
83 0.17
84 0.13
85 0.13
86 0.12
87 0.09
88 0.07
89 0.05
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.06
107 0.07
108 0.07
109 0.07
110 0.09
111 0.11
112 0.11
113 0.13
114 0.12
115 0.12
116 0.12
117 0.14
118 0.14
119 0.11
120 0.14
121 0.12
122 0.12
123 0.12
124 0.11
125 0.09
126 0.08
127 0.09
128 0.06
129 0.06
130 0.06
131 0.07
132 0.08
133 0.08
134 0.09
135 0.09
136 0.09
137 0.1
138 0.1
139 0.1
140 0.11
141 0.13
142 0.14
143 0.19
144 0.22
145 0.22
146 0.24
147 0.26
148 0.26
149 0.24
150 0.22
151 0.18
152 0.15
153 0.14
154 0.12
155 0.1
156 0.07
157 0.07
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.07
166 0.07
167 0.08
168 0.14
169 0.18
170 0.21
171 0.25
172 0.25
173 0.25
174 0.27
175 0.3
176 0.33
177 0.38
178 0.38
179 0.37
180 0.39
181 0.41
182 0.44
183 0.43
184 0.4
185 0.4
186 0.4
187 0.38
188 0.45
189 0.46
190 0.44
191 0.51
192 0.53
193 0.47
194 0.45
195 0.43
196 0.36
197 0.33
198 0.35
199 0.33
200 0.33
201 0.3
202 0.31
203 0.32
204 0.31
205 0.29
206 0.25
207 0.18
208 0.11
209 0.1
210 0.09
211 0.08
212 0.08
213 0.08
214 0.06
215 0.06
216 0.05
217 0.05
218 0.04
219 0.03
220 0.04
221 0.06
222 0.06
223 0.07
224 0.07
225 0.08
226 0.08
227 0.09
228 0.1
229 0.09
230 0.09
231 0.08
232 0.08
233 0.08
234 0.08
235 0.07
236 0.06
237 0.07
238 0.09
239 0.11
240 0.12
241 0.14
242 0.23
243 0.32
244 0.38
245 0.45
246 0.46
247 0.44
248 0.44
249 0.51
250 0.48
251 0.44
252 0.43
253 0.4
254 0.43
255 0.44
256 0.43
257 0.35
258 0.3
259 0.27
260 0.28
261 0.31
262 0.32
263 0.36
264 0.4
265 0.39
266 0.39
267 0.42
268 0.36
269 0.29
270 0.24
271 0.2
272 0.17
273 0.17
274 0.16
275 0.13
276 0.12
277 0.11
278 0.1
279 0.09
280 0.08
281 0.08
282 0.06
283 0.05
284 0.06
285 0.06
286 0.06
287 0.06
288 0.07
289 0.08
290 0.07
291 0.07
292 0.07
293 0.07
294 0.08
295 0.07
296 0.06
297 0.07
298 0.11
299 0.12
300 0.14
301 0.14
302 0.17
303 0.18
304 0.22
305 0.22
306 0.19
307 0.18
308 0.19
309 0.29
310 0.3
311 0.3
312 0.33
313 0.34
314 0.36
315 0.35
316 0.33
317 0.26
318 0.31
319 0.34
320 0.33
321 0.35
322 0.34
323 0.39
324 0.45
325 0.5
326 0.48
327 0.51
328 0.5
329 0.51
330 0.52
331 0.49
332 0.43
333 0.4
334 0.34
335 0.3
336 0.27
337 0.25
338 0.23
339 0.27
340 0.3
341 0.3
342 0.33
343 0.35
344 0.42
345 0.5
346 0.6
347 0.63
348 0.65
349 0.64
350 0.63
351 0.61
352 0.56
353 0.46
354 0.41
355 0.34
356 0.31
357 0.28
358 0.26
359 0.21
360 0.18
361 0.17
362 0.12
363 0.11
364 0.1
365 0.08
366 0.09
367 0.13
368 0.2
369 0.3
370 0.39
371 0.47
372 0.53
373 0.58
374 0.61
375 0.62
376 0.63
377 0.63
378 0.62
379 0.63
380 0.6
381 0.58
382 0.56
383 0.54
384 0.47
385 0.4
386 0.35
387 0.31
388 0.38
389 0.39
390 0.43
391 0.49
392 0.55
393 0.61
394 0.69
395 0.73
396 0.73
397 0.76
398 0.76
399 0.73
400 0.76
401 0.76
402 0.7
403 0.68
404 0.68
405 0.67
406 0.67
407 0.71
408 0.64