Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K0Y5

Protein Details
Accession A0A3N4K0Y5   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-43WKSPWRLSSSQKYRHRQRLRRVDRIVDHydrophilic
81-102FDPKEKTYRKGVHKLPKWTRMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_nucl 3.166, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRSTQARLSGLLWKSPWRLSSSQKYRHRQRLRRVDRIVDVLDKALAKQGMTAAAVERWKSEMPTEAEMKPRDKYTMFDPKEKTYRKGVHKLPKWTRMSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.25
4 0.28
5 0.3
6 0.31
7 0.32
8 0.29
9 0.32
10 0.37
11 0.46
12 0.51
13 0.59
14 0.66
15 0.73
16 0.78
17 0.85
18 0.88
19 0.86
20 0.87
21 0.88
22 0.87
23 0.87
24 0.82
25 0.75
26 0.67
27 0.62
28 0.52
29 0.42
30 0.33
31 0.23
32 0.2
33 0.15
34 0.12
35 0.11
36 0.1
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.09
49 0.09
50 0.1
51 0.1
52 0.14
53 0.16
54 0.19
55 0.22
56 0.21
57 0.27
58 0.29
59 0.31
60 0.28
61 0.26
62 0.26
63 0.24
64 0.24
65 0.26
66 0.35
67 0.36
68 0.41
69 0.43
70 0.48
71 0.56
72 0.58
73 0.54
74 0.53
75 0.58
76 0.6
77 0.66
78 0.68
79 0.7
80 0.74
81 0.81
82 0.81
83 0.82
84 0.79
85 0.78
86 0.79
87 0.79
88 0.8
89 0.77
90 0.79