Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JC00

Protein Details
Accession A0A3N4JC00    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
284-318DLMPKAKEKRLPEKVRKQPRSGTRRSMRDVKKDNIBasic
NLS Segment(s)
PositionSequence
92-105RSLRRRAGSKRTRS
288-311KAKEKRLPEKVRKQPRSGTRRSMR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTAGLRSRGGETQAPQLSECGHDRSCLDFGTDRDIKCRTCWENREILIQRLIEPFEHALGSFGVDAVVTGDAVVSSQTASTTPAERTTGRTRSLRRRAGSKRTRSESRGSTPTPKAQEMKEKTADGGYSLRSANRTMSEPEEEDCIRVQDLSLMRSRSQDSSGPVGKSIKPASHTTRFKEGGIKWWESGGPGTHGKSGKLIGRGNERSPSVASTPASRTKAATQPVKKPQQKTLFSFFTPRPAGDNSVPAPPSHAKSPDIPSPTISPTSSSQKNPAVVQAVKVDLMPKAKEKRLPEKVRKQPRSGTRRSMRDVKKDNINYKEDSDSDVDLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.32
4 0.29
5 0.29
6 0.29
7 0.25
8 0.22
9 0.23
10 0.24
11 0.27
12 0.27
13 0.23
14 0.24
15 0.22
16 0.22
17 0.29
18 0.33
19 0.29
20 0.32
21 0.35
22 0.33
23 0.32
24 0.4
25 0.38
26 0.44
27 0.5
28 0.51
29 0.56
30 0.56
31 0.63
32 0.58
33 0.55
34 0.49
35 0.43
36 0.4
37 0.34
38 0.34
39 0.24
40 0.23
41 0.2
42 0.17
43 0.16
44 0.13
45 0.12
46 0.11
47 0.11
48 0.08
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.07
67 0.08
68 0.11
69 0.12
70 0.14
71 0.16
72 0.17
73 0.23
74 0.29
75 0.33
76 0.35
77 0.41
78 0.47
79 0.55
80 0.64
81 0.66
82 0.62
83 0.67
84 0.71
85 0.76
86 0.78
87 0.77
88 0.76
89 0.76
90 0.79
91 0.73
92 0.71
93 0.66
94 0.63
95 0.59
96 0.53
97 0.53
98 0.5
99 0.52
100 0.49
101 0.46
102 0.42
103 0.38
104 0.45
105 0.43
106 0.46
107 0.43
108 0.4
109 0.37
110 0.35
111 0.32
112 0.23
113 0.19
114 0.14
115 0.12
116 0.12
117 0.13
118 0.13
119 0.13
120 0.13
121 0.13
122 0.15
123 0.15
124 0.17
125 0.18
126 0.18
127 0.18
128 0.19
129 0.18
130 0.16
131 0.15
132 0.12
133 0.1
134 0.09
135 0.08
136 0.09
137 0.1
138 0.11
139 0.14
140 0.15
141 0.16
142 0.18
143 0.2
144 0.17
145 0.18
146 0.19
147 0.18
148 0.21
149 0.24
150 0.22
151 0.22
152 0.23
153 0.21
154 0.23
155 0.22
156 0.18
157 0.17
158 0.22
159 0.27
160 0.34
161 0.37
162 0.37
163 0.43
164 0.43
165 0.4
166 0.43
167 0.37
168 0.36
169 0.37
170 0.35
171 0.28
172 0.28
173 0.27
174 0.21
175 0.21
176 0.13
177 0.12
178 0.12
179 0.13
180 0.16
181 0.17
182 0.17
183 0.17
184 0.19
185 0.19
186 0.22
187 0.23
188 0.23
189 0.31
190 0.34
191 0.34
192 0.35
193 0.32
194 0.28
195 0.27
196 0.26
197 0.18
198 0.18
199 0.17
200 0.17
201 0.21
202 0.25
203 0.27
204 0.25
205 0.26
206 0.27
207 0.32
208 0.36
209 0.41
210 0.4
211 0.47
212 0.57
213 0.65
214 0.67
215 0.65
216 0.68
217 0.69
218 0.7
219 0.66
220 0.64
221 0.58
222 0.53
223 0.54
224 0.45
225 0.43
226 0.39
227 0.33
228 0.29
229 0.27
230 0.31
231 0.27
232 0.31
233 0.24
234 0.28
235 0.28
236 0.24
237 0.27
238 0.25
239 0.27
240 0.26
241 0.28
242 0.25
243 0.3
244 0.35
245 0.37
246 0.38
247 0.36
248 0.34
249 0.34
250 0.35
251 0.33
252 0.28
253 0.24
254 0.24
255 0.31
256 0.34
257 0.34
258 0.37
259 0.39
260 0.42
261 0.4
262 0.4
263 0.38
264 0.34
265 0.33
266 0.3
267 0.26
268 0.23
269 0.23
270 0.2
271 0.16
272 0.2
273 0.2
274 0.25
275 0.32
276 0.37
277 0.43
278 0.5
279 0.58
280 0.65
281 0.73
282 0.76
283 0.8
284 0.85
285 0.9
286 0.91
287 0.87
288 0.85
289 0.85
290 0.84
291 0.82
292 0.82
293 0.81
294 0.81
295 0.82
296 0.83
297 0.81
298 0.81
299 0.81
300 0.77
301 0.78
302 0.79
303 0.8
304 0.77
305 0.73
306 0.66
307 0.61
308 0.59
309 0.49
310 0.44
311 0.38
312 0.31