Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UW08

Protein Details
Accession A0A383UW08    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-42LWKIPWRLSKFQKARQRKRLRAVDNVIHydrophilic
77-110KYTIFDRKEKNYRKSIRKLPKWTRVSQRINPPGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGSFRPTNSLMGGLLWKIPWRLSKFQKARQRKRLRAVDNVISVIDKALTKKGIVMKSIESWKNEMPIEQEMIPKDKYTIFDRKEKNYRKSIRKLPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.12
5 0.12
6 0.15
7 0.21
8 0.26
9 0.34
10 0.41
11 0.51
12 0.58
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.89
22 0.83
23 0.81
24 0.76
25 0.71
26 0.61
27 0.53
28 0.43
29 0.33
30 0.27
31 0.18
32 0.13
33 0.08
34 0.07
35 0.08
36 0.09
37 0.08
38 0.11
39 0.17
40 0.17
41 0.18
42 0.18
43 0.18
44 0.21
45 0.27
46 0.26
47 0.22
48 0.23
49 0.23
50 0.25
51 0.23
52 0.2
53 0.17
54 0.16
55 0.17
56 0.15
57 0.17
58 0.15
59 0.19
60 0.18
61 0.16
62 0.16
63 0.16
64 0.18
65 0.21
66 0.3
67 0.3
68 0.39
69 0.44
70 0.52
71 0.6
72 0.67
73 0.69
74 0.7
75 0.76
76 0.77
77 0.82
78 0.83
79 0.84
80 0.85
81 0.89
82 0.89
83 0.89
84 0.87
85 0.86
86 0.86
87 0.85
88 0.84
89 0.81
90 0.82