Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383USR5

Protein Details
Accession A0A383USR5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-127ERLAAKAEKRQLKKERQSKKLSKRPBasic
NLS Segment(s)
PositionSequence
107-127AKAEKRQLKKERQSKKLSKRP
Subcellular Location(s) mito 24, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSKTKAIALMREIPAVVVSAGHTQKTVKVRVGLKQLNSPIKNYSSQQRTQLVHDPNNSLRIGDIIAISSGSWVSKDVHYTVDRIIVPFGPPLEERPPVPTILERLAAKAEKRQLKKERQSKKLSKRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.15
4 0.08
5 0.08
6 0.13
7 0.14
8 0.14
9 0.15
10 0.14
11 0.2
12 0.25
13 0.28
14 0.25
15 0.3
16 0.33
17 0.39
18 0.48
19 0.47
20 0.43
21 0.46
22 0.49
23 0.51
24 0.49
25 0.45
26 0.39
27 0.37
28 0.37
29 0.34
30 0.35
31 0.33
32 0.35
33 0.38
34 0.41
35 0.4
36 0.41
37 0.47
38 0.43
39 0.41
40 0.41
41 0.39
42 0.34
43 0.35
44 0.31
45 0.23
46 0.18
47 0.14
48 0.12
49 0.09
50 0.07
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.05
60 0.06
61 0.07
62 0.09
63 0.09
64 0.13
65 0.14
66 0.15
67 0.14
68 0.17
69 0.17
70 0.16
71 0.16
72 0.13
73 0.13
74 0.13
75 0.13
76 0.1
77 0.1
78 0.14
79 0.17
80 0.18
81 0.18
82 0.21
83 0.22
84 0.21
85 0.22
86 0.2
87 0.2
88 0.2
89 0.24
90 0.2
91 0.2
92 0.24
93 0.25
94 0.25
95 0.28
96 0.35
97 0.39
98 0.45
99 0.54
100 0.6
101 0.68
102 0.77
103 0.8
104 0.82
105 0.83
106 0.89
107 0.89