Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UQC0

Protein Details
Accession A0A383UQC0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-29KPTACDRKRKAESQENNERLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046591  DUF6649  
Pfam View protein in Pfam  
PF20354  DUF6649  
Amino Acid Sequences MMNSPLRAVKPTACDRKRKAESQENNERLSKRLSLLKIGPNGHKLYPSVEQSNPSNQPLVTLNSIEPAALPAQISSNEVMHIDDTKHKVYIHDLDAELYECESEERNLVLCPAIKKRLLENSIPKTLLSDPSSDENNQLVLYSDPSSLTVAKEHDSVRRVIMESRARVRAQQDQQRKMGELQSEATPHSFTKLNQILEHKNLHDHKINSNEIISGYDPDAMELDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.73
4 0.76
5 0.76
6 0.76
7 0.75
8 0.79
9 0.79
10 0.83
11 0.77
12 0.73
13 0.71
14 0.62
15 0.54
16 0.48
17 0.4
18 0.33
19 0.36
20 0.34
21 0.35
22 0.39
23 0.43
24 0.46
25 0.48
26 0.48
27 0.45
28 0.46
29 0.41
30 0.37
31 0.31
32 0.29
33 0.3
34 0.3
35 0.3
36 0.28
37 0.31
38 0.32
39 0.38
40 0.38
41 0.33
42 0.3
43 0.26
44 0.26
45 0.25
46 0.25
47 0.19
48 0.17
49 0.16
50 0.16
51 0.16
52 0.13
53 0.11
54 0.09
55 0.08
56 0.07
57 0.07
58 0.06
59 0.07
60 0.08
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.09
70 0.12
71 0.15
72 0.16
73 0.17
74 0.17
75 0.17
76 0.2
77 0.23
78 0.2
79 0.2
80 0.19
81 0.18
82 0.18
83 0.18
84 0.14
85 0.09
86 0.07
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.1
99 0.13
100 0.16
101 0.17
102 0.17
103 0.2
104 0.26
105 0.28
106 0.3
107 0.36
108 0.38
109 0.4
110 0.39
111 0.36
112 0.31
113 0.29
114 0.28
115 0.21
116 0.17
117 0.15
118 0.17
119 0.2
120 0.18
121 0.18
122 0.14
123 0.13
124 0.12
125 0.1
126 0.09
127 0.07
128 0.09
129 0.09
130 0.09
131 0.08
132 0.09
133 0.1
134 0.1
135 0.1
136 0.1
137 0.1
138 0.11
139 0.14
140 0.15
141 0.18
142 0.2
143 0.2
144 0.2
145 0.2
146 0.2
147 0.2
148 0.26
149 0.28
150 0.31
151 0.35
152 0.38
153 0.36
154 0.38
155 0.4
156 0.42
157 0.44
158 0.49
159 0.54
160 0.56
161 0.6
162 0.59
163 0.57
164 0.5
165 0.46
166 0.39
167 0.31
168 0.27
169 0.25
170 0.24
171 0.23
172 0.21
173 0.18
174 0.16
175 0.17
176 0.17
177 0.14
178 0.24
179 0.29
180 0.31
181 0.33
182 0.4
183 0.42
184 0.45
185 0.49
186 0.4
187 0.43
188 0.43
189 0.45
190 0.46
191 0.43
192 0.46
193 0.49
194 0.51
195 0.44
196 0.41
197 0.37
198 0.3
199 0.3
200 0.24
201 0.18
202 0.16
203 0.17
204 0.16
205 0.15