Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383UK31

Protein Details
Accession A0A383UK31   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
27-57FKDKPVQHRHHLSRLLRKSRRLTSRLCRPHPBasic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021047  Mannosyltransferase_CMT1  
Pfam View protein in Pfam  
PF11735  CAP59_mtransfer  
Amino Acid Sequences MTPIRANYERLPTFRRDSVGEHLEDDFKDKPVQHRHHLSRLLRKSRRLTSRLCRPHPLLALLFGLLGLQLLWNGSYGEHSAPKFQVNKAEKVFIAANIINGELIESAWGPRLLSLIELIGSDRTFVSIYGGPSLELRQLEEKLKCNHKIVIEESEPVKLDTLPKTMLPDGLPRIKRIAFLAQVRNKVLEPLVDLETQGIVFGKVLFINDVYFEPAEALRLIWGTNVDEHGNAEYKAACAADFSTSWKYYDTFATRDAEGYSLGVPIYPWFSSEGEAVSRKDVLAGRDAVRVKSCWGGMVSFDARYFTPNSPSLSDHARLNTSMQVPLPLRFRSEPEPFWDSSECCLIHADISALPDLHRAGDEAREHDSGIYMNPYVRTAYSEGAFAWIPVAKRFERLLAPLQHLINRLAQMPRPNYRRTEVAGQLVDDQRWISYSLSPNRTSARVPHRQEASADVWRQRGFYEKVKRVARRGGYCGVRQLLVLKEEEFSEEDNGKGGQNWDNLLASVPPLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.43
4 0.42
5 0.46
6 0.47
7 0.42
8 0.38
9 0.36
10 0.36
11 0.33
12 0.32
13 0.25
14 0.22
15 0.25
16 0.26
17 0.33
18 0.41
19 0.49
20 0.54
21 0.63
22 0.69
23 0.73
24 0.79
25 0.79
26 0.79
27 0.82
28 0.83
29 0.8
30 0.81
31 0.8
32 0.81
33 0.83
34 0.78
35 0.77
36 0.76
37 0.8
38 0.82
39 0.79
40 0.78
41 0.72
42 0.73
43 0.68
44 0.62
45 0.52
46 0.44
47 0.39
48 0.3
49 0.26
50 0.18
51 0.13
52 0.08
53 0.07
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.07
63 0.09
64 0.11
65 0.16
66 0.16
67 0.2
68 0.21
69 0.27
70 0.29
71 0.3
72 0.37
73 0.38
74 0.45
75 0.44
76 0.46
77 0.4
78 0.4
79 0.39
80 0.29
81 0.29
82 0.22
83 0.2
84 0.17
85 0.17
86 0.13
87 0.12
88 0.11
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.08
95 0.08
96 0.08
97 0.08
98 0.09
99 0.08
100 0.08
101 0.08
102 0.06
103 0.07
104 0.07
105 0.07
106 0.08
107 0.07
108 0.08
109 0.07
110 0.08
111 0.07
112 0.07
113 0.1
114 0.12
115 0.13
116 0.14
117 0.14
118 0.14
119 0.14
120 0.15
121 0.15
122 0.12
123 0.14
124 0.14
125 0.17
126 0.23
127 0.26
128 0.31
129 0.35
130 0.43
131 0.45
132 0.44
133 0.45
134 0.42
135 0.43
136 0.4
137 0.39
138 0.33
139 0.32
140 0.3
141 0.28
142 0.26
143 0.22
144 0.19
145 0.13
146 0.16
147 0.15
148 0.17
149 0.16
150 0.16
151 0.19
152 0.19
153 0.2
154 0.17
155 0.19
156 0.22
157 0.29
158 0.29
159 0.27
160 0.31
161 0.29
162 0.29
163 0.27
164 0.27
165 0.24
166 0.3
167 0.38
168 0.39
169 0.42
170 0.41
171 0.4
172 0.35
173 0.31
174 0.26
175 0.17
176 0.13
177 0.13
178 0.14
179 0.13
180 0.13
181 0.12
182 0.11
183 0.11
184 0.09
185 0.06
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.07
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.06
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.05
211 0.06
212 0.07
213 0.07
214 0.07
215 0.08
216 0.08
217 0.09
218 0.09
219 0.09
220 0.07
221 0.07
222 0.08
223 0.07
224 0.06
225 0.05
226 0.06
227 0.06
228 0.06
229 0.09
230 0.12
231 0.12
232 0.13
233 0.14
234 0.14
235 0.14
236 0.18
237 0.18
238 0.16
239 0.17
240 0.18
241 0.18
242 0.18
243 0.17
244 0.13
245 0.1
246 0.09
247 0.07
248 0.06
249 0.05
250 0.05
251 0.04
252 0.04
253 0.06
254 0.05
255 0.06
256 0.07
257 0.08
258 0.09
259 0.09
260 0.1
261 0.1
262 0.12
263 0.12
264 0.11
265 0.11
266 0.1
267 0.12
268 0.13
269 0.12
270 0.13
271 0.15
272 0.16
273 0.21
274 0.22
275 0.2
276 0.2
277 0.19
278 0.17
279 0.17
280 0.16
281 0.12
282 0.12
283 0.11
284 0.1
285 0.14
286 0.13
287 0.12
288 0.12
289 0.12
290 0.11
291 0.13
292 0.15
293 0.12
294 0.16
295 0.18
296 0.2
297 0.21
298 0.22
299 0.22
300 0.23
301 0.24
302 0.21
303 0.2
304 0.2
305 0.18
306 0.18
307 0.2
308 0.17
309 0.17
310 0.15
311 0.18
312 0.18
313 0.2
314 0.23
315 0.19
316 0.22
317 0.21
318 0.25
319 0.27
320 0.31
321 0.29
322 0.31
323 0.34
324 0.32
325 0.33
326 0.32
327 0.26
328 0.23
329 0.26
330 0.2
331 0.17
332 0.17
333 0.14
334 0.13
335 0.12
336 0.11
337 0.08
338 0.09
339 0.09
340 0.08
341 0.08
342 0.09
343 0.09
344 0.08
345 0.07
346 0.07
347 0.08
348 0.13
349 0.14
350 0.15
351 0.19
352 0.19
353 0.19
354 0.18
355 0.18
356 0.13
357 0.12
358 0.12
359 0.09
360 0.1
361 0.1
362 0.11
363 0.11
364 0.11
365 0.13
366 0.13
367 0.15
368 0.14
369 0.14
370 0.13
371 0.14
372 0.14
373 0.11
374 0.1
375 0.1
376 0.11
377 0.13
378 0.17
379 0.15
380 0.19
381 0.2
382 0.22
383 0.23
384 0.26
385 0.31
386 0.32
387 0.35
388 0.36
389 0.37
390 0.36
391 0.36
392 0.34
393 0.29
394 0.25
395 0.24
396 0.23
397 0.25
398 0.3
399 0.34
400 0.41
401 0.44
402 0.47
403 0.48
404 0.49
405 0.5
406 0.47
407 0.49
408 0.44
409 0.45
410 0.42
411 0.39
412 0.4
413 0.38
414 0.33
415 0.26
416 0.22
417 0.15
418 0.15
419 0.16
420 0.12
421 0.15
422 0.24
423 0.32
424 0.38
425 0.39
426 0.41
427 0.43
428 0.44
429 0.4
430 0.41
431 0.42
432 0.46
433 0.51
434 0.56
435 0.57
436 0.56
437 0.55
438 0.52
439 0.48
440 0.45
441 0.44
442 0.4
443 0.41
444 0.39
445 0.39
446 0.34
447 0.36
448 0.33
449 0.38
450 0.46
451 0.48
452 0.57
453 0.65
454 0.71
455 0.7
456 0.74
457 0.73
458 0.69
459 0.68
460 0.67
461 0.64
462 0.61
463 0.61
464 0.54
465 0.45
466 0.38
467 0.37
468 0.32
469 0.28
470 0.27
471 0.21
472 0.2
473 0.2
474 0.22
475 0.19
476 0.17
477 0.19
478 0.18
479 0.18
480 0.18
481 0.19
482 0.17
483 0.18
484 0.19
485 0.2
486 0.22
487 0.23
488 0.24
489 0.24
490 0.24
491 0.23
492 0.2
493 0.15