Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A383UQ28

Protein Details
Accession A0A383UQ28    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
64-85EFTWCARRPDCEKKAPKRSGGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTSTNGQLSSMLQGIVIEPINRLGIILGKHHGSLSFGDEKRENDKLRMAFKYGCLIYVVNQKQEFTWCARRPDCEKKAPKRSGGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.11
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.09
10 0.07
11 0.09
12 0.09
13 0.11
14 0.11
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.1
21 0.13
22 0.19
23 0.18
24 0.2
25 0.22
26 0.24
27 0.27
28 0.31
29 0.28
30 0.22
31 0.27
32 0.28
33 0.3
34 0.3
35 0.29
36 0.24
37 0.24
38 0.28
39 0.23
40 0.2
41 0.17
42 0.16
43 0.15
44 0.24
45 0.25
46 0.25
47 0.25
48 0.25
49 0.25
50 0.28
51 0.27
52 0.24
53 0.33
54 0.33
55 0.41
56 0.43
57 0.49
58 0.54
59 0.63
60 0.64
61 0.65
62 0.7
63 0.73
64 0.81
65 0.83
66 0.82