Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383V287

Protein Details
Accession A0A383V287   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
312-337IAGPRGKGSKSKKSGKTRSKNIEEIEHydrophilic
NLS Segment(s)
PositionSequence
30-30R
314-330GPRGKGSKSKKSGKTRS
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002745  Ptrans_KptA/Tpt1  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF01885  PTS_2-RNA  
Amino Acid Sequences MAAAVLQPQRPSFEIMAPSPISPKASRHGRSRHGGSISKNNKTRGRGYSVIDERETLIAKAILRLLKRTVEEDEEQKKEKEEDETLVPDLDGWFGVDAILAHSSLTAFHTTLPELKAIASASKARFALKLKPDTITSEAQQTAPKEENEIPEELRAPINELVTPEKEYPASAYLIRSIQSNIIAQITPLSLKSNELPDLIFYETSYANYPLILASGGIKRAGGQSYLSFKTITLSNGSDLPPVTADISIYIDLRSAMESYSEIEWSQSESGSVLTKGDAEGMVSKAMWKNVVARRADIGIIFENGEVKKDLIAGPRGKGSKSKKSGKTRSKNIEEIESCSVDKEIPGTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.34
4 0.32
5 0.31
6 0.29
7 0.28
8 0.28
9 0.25
10 0.27
11 0.3
12 0.39
13 0.45
14 0.52
15 0.59
16 0.63
17 0.7
18 0.73
19 0.71
20 0.68
21 0.67
22 0.63
23 0.65
24 0.65
25 0.65
26 0.65
27 0.65
28 0.65
29 0.65
30 0.67
31 0.62
32 0.62
33 0.57
34 0.56
35 0.58
36 0.58
37 0.56
38 0.49
39 0.44
40 0.37
41 0.34
42 0.31
43 0.21
44 0.17
45 0.15
46 0.15
47 0.16
48 0.18
49 0.19
50 0.19
51 0.22
52 0.23
53 0.25
54 0.26
55 0.27
56 0.27
57 0.28
58 0.31
59 0.36
60 0.4
61 0.4
62 0.42
63 0.4
64 0.39
65 0.35
66 0.34
67 0.31
68 0.26
69 0.25
70 0.25
71 0.27
72 0.25
73 0.24
74 0.21
75 0.17
76 0.14
77 0.11
78 0.08
79 0.06
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.05
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.1
98 0.13
99 0.13
100 0.12
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.1
107 0.14
108 0.14
109 0.17
110 0.18
111 0.17
112 0.2
113 0.22
114 0.29
115 0.31
116 0.36
117 0.34
118 0.35
119 0.36
120 0.36
121 0.37
122 0.31
123 0.24
124 0.22
125 0.22
126 0.21
127 0.23
128 0.2
129 0.19
130 0.19
131 0.19
132 0.18
133 0.2
134 0.22
135 0.21
136 0.22
137 0.19
138 0.17
139 0.18
140 0.15
141 0.14
142 0.11
143 0.11
144 0.11
145 0.12
146 0.11
147 0.12
148 0.13
149 0.13
150 0.16
151 0.13
152 0.13
153 0.12
154 0.12
155 0.12
156 0.11
157 0.11
158 0.09
159 0.09
160 0.1
161 0.11
162 0.11
163 0.1
164 0.09
165 0.09
166 0.1
167 0.1
168 0.08
169 0.09
170 0.08
171 0.08
172 0.08
173 0.07
174 0.06
175 0.06
176 0.07
177 0.07
178 0.08
179 0.09
180 0.11
181 0.12
182 0.12
183 0.11
184 0.1
185 0.12
186 0.12
187 0.1
188 0.08
189 0.09
190 0.08
191 0.09
192 0.11
193 0.09
194 0.09
195 0.08
196 0.09
197 0.07
198 0.07
199 0.06
200 0.04
201 0.06
202 0.07
203 0.08
204 0.08
205 0.08
206 0.08
207 0.1
208 0.11
209 0.09
210 0.09
211 0.11
212 0.17
213 0.18
214 0.18
215 0.17
216 0.16
217 0.17
218 0.18
219 0.16
220 0.14
221 0.13
222 0.13
223 0.15
224 0.16
225 0.15
226 0.14
227 0.13
228 0.11
229 0.1
230 0.1
231 0.08
232 0.07
233 0.07
234 0.08
235 0.09
236 0.09
237 0.08
238 0.07
239 0.08
240 0.08
241 0.08
242 0.07
243 0.06
244 0.06
245 0.07
246 0.09
247 0.09
248 0.1
249 0.09
250 0.09
251 0.09
252 0.11
253 0.11
254 0.09
255 0.08
256 0.08
257 0.09
258 0.1
259 0.1
260 0.08
261 0.08
262 0.08
263 0.08
264 0.09
265 0.08
266 0.07
267 0.09
268 0.09
269 0.1
270 0.09
271 0.12
272 0.14
273 0.15
274 0.15
275 0.14
276 0.22
277 0.27
278 0.34
279 0.33
280 0.32
281 0.33
282 0.34
283 0.33
284 0.25
285 0.22
286 0.17
287 0.16
288 0.15
289 0.13
290 0.16
291 0.15
292 0.16
293 0.15
294 0.13
295 0.13
296 0.14
297 0.17
298 0.19
299 0.26
300 0.28
301 0.29
302 0.36
303 0.37
304 0.37
305 0.43
306 0.46
307 0.49
308 0.56
309 0.64
310 0.67
311 0.76
312 0.86
313 0.88
314 0.91
315 0.9
316 0.92
317 0.89
318 0.87
319 0.79
320 0.78
321 0.69
322 0.64
323 0.58
324 0.5
325 0.42
326 0.35
327 0.32
328 0.22
329 0.21
330 0.17
331 0.14