Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383V210

Protein Details
Accession A0A383V210   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-130KTNVKRPSNKERKALKAKQKGYFKPHydrophilic
NLS Segment(s)
PositionSequence
110-138KRPSNKERKALKAKQKGYFKPNNKPDLRK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MSINISQEELFEFHTAHFSEINVDHFAENFLGPVALNPEDHLGYYEDGSERTLTDAQICIFRHTEIQNLYRERQYMRESNGEMNADNPPEIQITKSSDASCSSSNKTNVKRPSNKERKALKAKQKGYFKPNNKPDLRKRTWDKVEPGYGSLNYDEAQGGVDSNQPRSLQRRRISYGEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.15
5 0.13
6 0.16
7 0.17
8 0.19
9 0.17
10 0.17
11 0.16
12 0.15
13 0.16
14 0.13
15 0.12
16 0.09
17 0.08
18 0.07
19 0.06
20 0.07
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.11
27 0.11
28 0.12
29 0.11
30 0.11
31 0.11
32 0.11
33 0.1
34 0.1
35 0.11
36 0.1
37 0.08
38 0.1
39 0.11
40 0.1
41 0.11
42 0.11
43 0.11
44 0.16
45 0.16
46 0.16
47 0.16
48 0.16
49 0.18
50 0.18
51 0.21
52 0.2
53 0.23
54 0.26
55 0.28
56 0.3
57 0.28
58 0.29
59 0.26
60 0.27
61 0.28
62 0.26
63 0.27
64 0.29
65 0.29
66 0.29
67 0.3
68 0.26
69 0.21
70 0.18
71 0.16
72 0.12
73 0.11
74 0.09
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.11
81 0.13
82 0.14
83 0.14
84 0.15
85 0.16
86 0.18
87 0.18
88 0.17
89 0.18
90 0.22
91 0.26
92 0.32
93 0.35
94 0.41
95 0.47
96 0.54
97 0.61
98 0.63
99 0.7
100 0.74
101 0.76
102 0.77
103 0.76
104 0.77
105 0.78
106 0.8
107 0.8
108 0.79
109 0.8
110 0.79
111 0.81
112 0.77
113 0.76
114 0.77
115 0.74
116 0.74
117 0.76
118 0.77
119 0.74
120 0.77
121 0.78
122 0.79
123 0.77
124 0.76
125 0.75
126 0.76
127 0.78
128 0.76
129 0.72
130 0.69
131 0.7
132 0.61
133 0.55
134 0.48
135 0.4
136 0.34
137 0.28
138 0.22
139 0.16
140 0.15
141 0.13
142 0.09
143 0.1
144 0.08
145 0.08
146 0.07
147 0.13
148 0.14
149 0.16
150 0.19
151 0.2
152 0.24
153 0.32
154 0.41
155 0.46
156 0.51
157 0.58
158 0.6