Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A383V163

Protein Details
Accession A0A383V163    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
102-128EERNAAKEEKRRLKQERSEKKLSNKLLHydrophilic
NLS Segment(s)
PositionSequence
108-122KEEKRRLKQERSEKK
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSKSRAIALMREIPAVVVSAGLMQKTVKVQVGVQQWNSHIKKYFNRRRNHLVHDPNDSVRIGDIVAISAGSRVAKHVRHVVTKIIAPFGVPIEERPPIPTIEERNAAKEEKRRLKQERSEKKLSNKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.14
4 0.06
5 0.05
6 0.07
7 0.08
8 0.08
9 0.08
10 0.07
11 0.09
12 0.1
13 0.13
14 0.12
15 0.12
16 0.13
17 0.19
18 0.26
19 0.29
20 0.29
21 0.29
22 0.29
23 0.38
24 0.38
25 0.35
26 0.32
27 0.32
28 0.38
29 0.48
30 0.56
31 0.55
32 0.61
33 0.65
34 0.71
35 0.72
36 0.73
37 0.71
38 0.69
39 0.64
40 0.63
41 0.58
42 0.49
43 0.44
44 0.36
45 0.26
46 0.18
47 0.14
48 0.08
49 0.07
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.04
57 0.03
58 0.03
59 0.05
60 0.09
61 0.1
62 0.13
63 0.2
64 0.22
65 0.26
66 0.27
67 0.29
68 0.27
69 0.29
70 0.27
71 0.21
72 0.18
73 0.14
74 0.14
75 0.11
76 0.11
77 0.08
78 0.09
79 0.11
80 0.12
81 0.13
82 0.14
83 0.15
84 0.14
85 0.17
86 0.2
87 0.23
88 0.26
89 0.32
90 0.31
91 0.34
92 0.36
93 0.35
94 0.36
95 0.38
96 0.44
97 0.49
98 0.55
99 0.62
100 0.67
101 0.75
102 0.8
103 0.84
104 0.85
105 0.83
106 0.85
107 0.83
108 0.84